Recombinant Methylovorus sp. NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Msip34_0681; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Methylovorus glucosetrophus (strain SIP3-4)
Target Names
nuoK
Target Protein Sequence
MVGLSHYLILGSLLFAISVVGIFLNRKNVIVLLMAIELMLLAVNLNFIAFSHYLQDTAGQ VFVFFILTVAAAESAIGLAILVVLFRNLKTINVDDINSLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the enzyme's primary electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), thereby conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NADH-quinone oxidoreductase in bacterial metabolism?

NADH-quinone oxidoreductase functions as a critical enzyme in the respiratory chain, catalyzing the transfer of electrons from NADH to quinones while simultaneously pumping protons across the membrane. Methodologically, its role can be studied through:

  • Oxygen consumption measurements using oxygen electrodes

  • Membrane potential analysis with fluorescent dyes

  • Proton-pumping activity assessment using pH-sensitive probes

  • Electron transfer kinetics through spectrophotometric assays

This oxidoreductase participates in both aerobic and anaerobic metabolism, contributing to processes such as the TCA cycle, oxidative phosphorylation, and amino acid metabolism . Research approaches typically involve comparing wild-type and mutant strains to assess metabolic flux changes when this complex is impaired.

How does the structure of nuoK relate to its function in the NADH-quinone oxidoreductase complex?

The structure-function relationship of nuoK can be methodologically investigated through:

Structural FeatureFunctional ImplicationResearch Method
Transmembrane helicesMembrane anchoring and proton channel formationSite-directed mutagenesis followed by activity assays
Conserved residuesElectron transfer and proton pumpingAlanine scanning mutagenesis
Protein-protein interaction domainsAssembly of Complex ICrosslinking studies and co-immunoprecipitation
Redox-active sitesElectron transfer pathwayEPR spectroscopy and redox titration

The hydrophobic nature of nuoK (as evidenced by its amino acid sequence) suggests it plays a role in membrane integration of Complex I . To experimentally investigate this, researchers typically use recombinant expression systems combined with membrane fractionation and activity assays to correlate structural features with functional outcomes .

How can machine learning approaches be applied to predict substrate specificity of NADH-quinone oxidoreductase?

Machine learning methodologies can be leveraged to predict substrate specificity through:

  • Feature extraction from atomic properties: Extract QSPR (Quantitative Structure-Property Relationship) descriptors from the 2D chemical structure of potential substrates. These descriptors capture atomic features that influence reactivity patterns .

  • Classification algorithm training: Utilize Support Vector Machines (SVMs) with linear kernels trained on positive examples (known substrates) and negative examples (non-substrates). The KEGG database provides valuable training data with 1956 oxidation/reduction reactions, of which many involve NADH-quinone oxidoreductases .

  • Pattern recognition in reaction centers: Identify characteristic functional group transformations and local structural motifs in compounds that serve as substrates for nuoK. Research shows that the vast majority of oxidoreductase reactions can be divided into 12 subclasses, each marked by a particular type of functional group transformation .

  • Validation through cross-referencing: Compare predictions against experimentally verified substrates with sensitivity analysis to ensure robustness to variations in training data.

This methodological approach has demonstrated prediction accuracy ranging from 64% to 93% for substrates and 71% to 98% for products in oxidoreductase-catalyzed reactions .

What strategies can be employed to enhance the stability and activity of recombinant nuoK protein for in vitro studies?

Methodological approaches to enhance stability and activity include:

Enhancement StrategyImplementation MethodExpected Outcome
Buffer optimizationSystematic screening of pH, salt concentration, and additivesIdentification of conditions that maximize protein stability
Addition of stabilizing agentsIncorporation of glycerol (5-50%), trehalose, or other osmolytesPrevention of protein aggregation during storage
Reconstitution techniquesDeionized sterile water reconstitution to 0.1-1.0 mg/mLPreparation of functional protein for assays
Storage protocol refinementAliquoting and storage at -20°C/-80°CAvoidance of freeze-thaw cycles that reduce activity
Protein engineeringSite-directed mutagenesis of destabilizing residuesEnhanced thermostability without loss of function

For optimal results, the recombinant protein should be briefly centrifuged prior to opening, and glycerol should be added to a final concentration of 50% before long-term storage, as these steps have been experimentally validated to maintain functional integrity .

How do post-translational modifications affect nuoK activity within the NADH-quinone oxidoreductase complex?

Methodological investigation of post-translational modifications (PTMs) can be approached through:

  • Mass spectrometry-based proteomics: Employ tandem MS/MS to identify and quantify site-specific modifications. Sample preparation should include enrichment techniques specific to the PTM of interest (e.g., phosphopeptide enrichment using titanium dioxide).

  • Site-directed mutagenesis: Generate mutants at potential modification sites by substituting modifiable residues with non-modifiable analogs (e.g., serine to alanine for phosphorylation sites). Compare activity of wild-type and mutant proteins.

  • In vitro modification systems: Reconstitute modification reactions using purified kinases, phosphatases, or other modifying enzymes to assess direct effects on nuoK activity.

  • Temporal dynamics analysis: Use pulse-chase experiments with activity correlation to determine how modifications change during different metabolic states.

These approaches reveal how PTMs regulate electron transfer efficiency, complex assembly, membrane integration, and protein-protein interactions within the respiratory chain.

What is the optimal protocol for expressing and purifying recombinant nuoK protein?

A methodological approach for expression and purification should include:

  • Construct design:

    • Clone the nuoK gene (Methylovorus glucosetrophus) into an expression vector with an N-terminal His-tag

    • Verify sequence integrity through Sanger sequencing

    • Transform into an E. coli expression host (e.g., BL21(DE3))

  • Expression optimization:

    • Test induction conditions: IPTG concentration (0.1-1.0 mM), temperature (16-37°C), and duration (4-24 hours)

    • Assess expression levels via SDS-PAGE and Western blot

    • Perform small-scale expression tests before scaling up

  • Purification workflow:

    • Lyse cells in Tris/PBS-based buffer with protease inhibitors

    • Perform Ni-NTA affinity chromatography

    • Execute size exclusion chromatography for final polishing

    • Validate purity (>90%) using SDS-PAGE

  • Storage preparation:

    • Formulate in Tris/PBS-based buffer with 6% trehalose, pH 8.0

    • Lyophilize or store as aliquots at -80°C with 50% glycerol

    • Avoid repeated freeze-thaw cycles which compromise activity

This protocol has been demonstrated to yield functional protein suitable for subsequent enzymatic and structural studies.

How can researchers accurately measure electron transfer activity of purified nuoK in reconstituted systems?

Methodological approaches for measuring electron transfer activity include:

  • Spectrophotometric assays:

    • Monitor NADH oxidation at 340 nm

    • Track quinone reduction using wavelength-specific absorption changes

    • Calculate electron transfer rates using extinction coefficients

  • Oxygen consumption measurements:

    • Employ Clark-type oxygen electrodes to measure respiratory activity

    • Correlate oxygen reduction with electron transfer through the complex

    • Perform inhibitor studies to confirm specificity

  • Artificial electron acceptor systems:

    • Use water-soluble analogs of ubiquinone (e.g., CoQ1 or decylubiquinone)

    • Incorporate membrane-mimetic systems (liposomes, nanodiscs) for proper protein folding

    • Quantify electron transfer using colorimetric electron acceptors

  • Electrochemical detection:

    • Develop protein-film voltammetry on modified electrodes

    • Measure direct electron transfer between enzyme and electrode surface

    • Analyze catalytic waves to determine enzyme kinetics

For optimal results, researchers should perform controls with specific inhibitors (e.g., rotenone, piericidin A) to confirm that measured activity is specifically due to nuoK function within Complex I.

What approaches can be used to study protein-protein interactions between nuoK and other subunits of the NADH-quinone oxidoreductase complex?

Methodological strategies to study protein-protein interactions include:

TechniqueImplementationData OutputAdvantages
Crosslinking coupled with MSApply chemical crosslinkers followed by tryptic digestion and MS analysisIdentification of interaction sites at amino acid resolutionCaptures transient interactions in native environment
Co-immunoprecipitationPull down nuoK using antibodies and identify interacting partnersQualitative assessment of binding partnersWorks with endogenous protein levels
Surface Plasmon ResonanceImmobilize nuoK on sensor chip and flow other subunits over surfaceBinding kinetics (kon, koff) and affinity constants (KD)Real-time monitoring of interactions
FRET/BRETTag nuoK and potential partners with fluorescent/bioluminescent proteinsEnergy transfer efficiency correlating with proximityCan be performed in living cells
Hydrogen-deuterium exchange MSMonitor differential deuterium incorporation with and without binding partnersStructural information about interaction interfacesProvides dynamics of protein interactions
Bacterial two-hybrid assaysCreate fusion constructs with split reporter proteinsBinary indication of protein interactionsHigh-throughput screening capability

These methods collectively provide complementary information about the quaternary structure of Complex I and the specific role of nuoK in complex assembly and stability.

How can researchers differentiate between direct and indirect effects when analyzing nuoK knockout phenotypes?

Methodological approaches to differentiate direct and indirect effects include:

  • Genetic complementation studies:

    • Reintroduce wild-type nuoK gene to knockout strains

    • Introduce point-mutated versions of nuoK with specific functional defects

    • Compare phenotypic rescue patterns to identify primary and secondary effects

  • Time-resolved experiments:

    • Monitor changes in metabolite levels, gene expression, and cellular physiology at multiple time points after conditional knockdown

    • Construct temporal networks to identify primary (rapid) versus secondary (delayed) effects

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data from nuoK knockout models

    • Use pathway enrichment analysis to distinguish direct biochemical pathways from compensatory responses

    • Apply causal network inference algorithms to establish directionality of effects

  • Dose-dependent inhibition studies:

    • Use chemical inhibitors or titratable expression systems to create varying degrees of nuoK inhibition

    • Analyze dose-response relationships to identify primary targets (steeper response curves) versus secondary effects

This systematic approach allows researchers to construct accurate models of nuoK function within the cellular context while avoiding misattribution of phenotypes to direct enzymatic activities.

What statistical methods are most appropriate for analyzing enzymatic parameters of nuoK-containing complexes?

Appropriate statistical methods include:

  • Enzyme kinetics analysis:

    • Apply non-linear regression for Michaelis-Menten kinetics

    • Use Eadie-Hofstee or Lineweaver-Burk transformations for detecting complex kinetic patterns

    • Implement global fitting for multi-substrate reactions following ping-pong or sequential mechanisms

  • Comparative analysis:

    • Employ ANOVA with post-hoc tests for comparing parameters across multiple experimental conditions

    • Use paired t-tests for before/after comparisons when testing effectors

    • Apply non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) when normality assumptions are violated

  • Inhibition studies:

    • Fit competitive, uncompetitive, and mixed inhibition models

    • Calculate IC50 values using four-parameter logistic regression

    • Determine inhibition constants (Ki) through appropriate replots

  • Quality control and validation:

    • Implement bootstrapping to estimate parameter confidence intervals

    • Use residual analysis to validate model goodness-of-fit

    • Perform sensitivity analysis to identify parameters most affecting model outcomes

These statistical approaches ensure robust interpretation of enzymatic data, particularly when analyzing the complex electron transfer mechanisms associated with nuoK function in oxidoreductase complexes.

How can researchers integrate structural and functional data to build comprehensive models of nuoK activity?

Methodological framework for integrating structural and functional data:

  • Structural data acquisition and analysis:

    • Generate or acquire atomic structures through X-ray crystallography, cryo-EM, or homology modeling

    • Identify functional domains, conserved residues, and potential catalytic sites

    • Analyze transmembrane topology using hydropathy plots and the nuoK amino acid sequence

  • Functional characterization:

    • Measure electron transfer rates under varying conditions

    • Assess proton pumping efficiency using pH-sensitive probes

    • Determine inhibitor binding sites and mechanisms

  • Computational integration approaches:

    • Perform molecular dynamics simulations to connect static structures with dynamic functions

    • Use machine learning to identify structure-function relationships based on atomic properties

    • Develop quantitative models that predict functional outcomes from structural parameters

  • Iterative model refinement:

    • Design experiments to test model predictions

    • Update models based on new experimental data

    • Apply sensitivity analysis to identify key structural features that most significantly impact function

This integrative approach allows researchers to connect nuoK's molecular structure with its role in electron transfer and proton pumping, providing a mechanistic understanding of its function within the NADH-quinone oxidoreductase complex.

What are common challenges in recombinant nuoK expression and how can they be overcome?

Common challenges and methodological solutions include:

ChallengePossible CausesSolution Approaches
Low expression yieldToxicity to host cells, rare codons, improper foldingOptimize codon usage, use specialized expression strains (C41/C43), lower induction temperature (16-20°C), test different promoter systems
Protein aggregation/inclusion bodiesHydrophobic membrane protein, improper foldingAdd solubilizing agents, use fusion partners (MBP, SUMO), implement co-expression with chaperones
Poor stability after purificationDetergent mismatch, cofactor loss, proteolytic degradationScreen detergent panel, add stabilizing ligands, include protease inhibitors, optimize buffer conditions
Low enzymatic activityImproper folding, loss of cofactors, inactive conformationReconstitute with lipids/membrane mimetics, add essential cofactors, optimize protein:lipid ratios
Difficulty in detecting proteinPoor antibody recognition, low expressionUse epitope tags (His-tag already present) , optimize Western blot conditions, employ more sensitive detection methods

When working with nuoK, special attention should be paid to maintaining the protein in a native-like membrane environment, as its function depends on proper integration into a lipid bilayer. The use of amphipols, nanodiscs, or liposomes during or after purification can significantly improve protein stability and activity .

How can researchers troubleshoot inconsistent results in nuoK functional assays?

Methodological approach to troubleshooting inconsistent results:

  • Systematic quality control:

    • Verify protein quality via SDS-PAGE and Western blotting before each assay

    • Confirm protein concentration using multiple methods (Bradford, BCA, absorbance at 280 nm)

    • Check for batch-to-batch variation in purified protein

  • Assay component validation:

    • Test reagent stability and prepare fresh working solutions

    • Validate enzyme substrates (NADH, ubiquinone) for purity and activity

    • Control environmental variables (temperature, pH, ionic strength)

  • Instrument calibration and setup:

    • Perform regular calibration of spectrophotometers, oxygen electrodes, or other instruments

    • Run standard curves with known concentrations of reaction products

    • Include internal standards in each assay run

  • Experimental design optimization:

    • Implement factorial design to identify interacting variables

    • Use technical and biological replicates appropriately

    • Develop positive and negative controls specific to each assay

  • Data analysis refinement:

    • Apply statistical tests to quantify variability

    • Implement outlier detection algorithms

    • Use normalization procedures when appropriate

By systematically addressing each potential source of variation, researchers can significantly improve reproducibility in functional assays of recombinant nuoK.

What strategies can be employed to overcome the challenges of studying membrane-bound proteins like nuoK?

Methodological strategies include:

  • Specialized expression systems:

    • Use bacterial strains optimized for membrane protein expression (C41, C43)

    • Implement inducible promoters with tunable expression levels

    • Consider cell-free expression systems with supplied lipids or detergents

  • Solubilization and purification approaches:

    • Screen detergent panels (mild non-ionic, zwitterionic, and mixed micelles)

    • Implement detergent exchange during purification

    • Use affinity chromatography with the His-tag already designed into the construct

  • Membrane mimetic environments:

    • Reconstitute in proteoliposomes for functional studies

    • Use nanodiscs with defined lipid composition

    • Apply amphipathic polymers (amphipols) for stabilization

  • Advanced structural studies:

    • Optimize sample preparation for cryo-EM studies

    • Use lipidic cubic phase crystallization for X-ray studies

    • Apply solid-state NMR for specific structural questions

  • Functional characterization approaches:

    • Develop solid-supported membrane assays for electrogenic activity

    • Implement fluorescence-based assays compatible with membrane environments

    • Use surface-enhanced techniques to increase signal-to-noise ratio

These methodological approaches collectively address the unique challenges posed by the hydrophobic nature of nuoK and its requirement for a lipid environment to maintain native structure and function .

What are the emerging technologies that could advance our understanding of nuoK function and structure?

Methodological advances on the horizon include:

  • Single-molecule techniques:

    • Apply single-molecule FRET to monitor conformational changes during the catalytic cycle

    • Use optical tweezers to measure force generation during proton pumping

    • Implement single-particle tracking to observe complex assembly in living cells

  • Advanced imaging approaches:

    • Utilize super-resolution microscopy to visualize complex formation in situ

    • Apply correlative light and electron microscopy (CLEM) to connect function with structure

    • Develop cryo-electron tomography methods for studying nuoK in native membrane environments

  • Artificial intelligence integration:

    • Expand machine learning applications for predicting substrates and inhibitors

    • Implement deep learning for structure prediction and functional annotation

    • Develop AI-assisted experimental design for high-dimensional parameter optimization

  • Synthetic biology approaches:

    • Create minimal oxidoreductase systems using maquette protein design principles

    • Engineer orthogonal electron transfer chains with nuoK variants

    • Develop biosensors based on nuoK activity for metabolic engineering applications

These emerging technologies promise to provide unprecedented insights into the mechanistic details of nuoK function within the NADH-quinone oxidoreductase complex, potentially enabling novel applications in biotechnology and medicine.

How might research on nuoK contribute to broader applications in biotechnology and medicine?

Methodological pathways to translational applications include:

  • Bioenergy applications:

    • Engineer improved electron transfer efficiency for biofuel cells

    • Develop in vitro systems for coupled enzymatic production of high-value compounds

    • Create synthetic electron transport chains with optimized energy conservation

  • Drug discovery platforms:

    • Establish high-throughput screening systems for identifying nuoK inhibitors as antimicrobials

    • Develop assays for species-specific targeting of pathogen respiratory chains

    • Create biosensors for detecting respiratory chain modulators

  • Metabolic engineering:

    • Manipulate electron flow for enhanced production of reduced metabolites

    • Engineer redox balance in industrial microorganisms

    • Develop synthetic consortium approaches leveraging modified electron transfer chains

  • Medical applications:

    • Investigate nuoK as a target for antimicrobial development against pathogens

    • Study mitochondrial homologs for understanding human diseases

    • Develop nuoK-based systems for detoxification of xenobiotics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.