Recombinant Metridium senile ATP synthase subunit a (ATPASE6)

What is the molecular structure and characterization of Metridium senile ATPASE6?

Metridium senile ATP synthase subunit a (ATPASE6) is a 229 amino acid mitochondrial membrane protein (UniProt ID: O47494) found in the brown sea anemone (also called frilled sea anemone). The complete amino acid sequence is:

MGAAYFDQFKVVDLIAITNSSMMMMLAVAVALILLKGNRLIPNRWQAVMESIYDHFHGLVKDNSGPQYFPFVFTLFIFIVFLNILGLFPYVFTVTVHIVVTLGLSFSIVIGVTLGGLWKFKWNFLSILMPAGAPLALAPLLVLIETVSYISRAISLGVRLAANLSAGHLLFAILAGFGFNMLTTAGVFNIFPVLIMVFISLLEAAVAVIQAYVFSLLTTIYLADTIVLH

This protein functions as a critical component of the F-type ATP synthase complex in mitochondria, facilitating proton transport across the inner mitochondrial membrane during oxidative phosphorylation. For structural analysis, researchers typically employ recombinant ATPASE6 with N-terminal His-tags expressed in E. coli expression systems, followed by purification via affinity chromatography and subsequent characterization using circular dichroism spectroscopy to verify proper folding .

What are the optimal storage conditions for recombinant Metridium senile ATPASE6?

For optimal storage of recombinant Metridium senile ATPASE6, the following protocol is recommended:

• Store lyophilized protein at -20°C or -80°C for long-term storage

• After reconstitution, prepare working aliquots with 50% glycerol

• Store working aliquots at 4°C for up to one week

• Avoid repeated freeze-thaw cycles as this significantly reduces protein stability and activity

• For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

Research indicates that storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0 maintains optimal stability. For extended experiments requiring multiple uses, preparing multiple single-use aliquots is strongly recommended rather than repeatedly accessing the same stock .

How does the gene expression of ATPASE6 in Metridium senile compare to other mitochondrial genes?

Gene expression analysis of mitochondrial genes in Metridium senile reveals distinctive patterns for ATPASE6 compared to other mitochondrial components. Under normal physiological conditions, ATPASE6 shows constitutive expression, but this can be dramatically altered under various experimental conditions.

In studies examining mitochondrial dysfunction, ATPASE6 gene expression can be reduced over 800-fold when mitochondrial function is compromised, a much more pronounced effect than seen with other mitochondrial genes such as ND1-6 and ND4L, which typically show approximately 50-fold decreases under similar conditions . This extraordinary sensitivity makes ATPASE6 expression an excellent biomarker for mitochondrial health in experimental models.

The expression pattern correlates directly with ATP production capacity and oxidative phosphorylation (OXPHOS) activity, where decreased ATPASE6 expression is associated with reduced basal oxygen consumption rate (OCR), diminished respiratory function, and compromised ATP synthetic capability .

What methodologies are most effective for assessing the functional impact of recombinant ATPASE6 in mitochondrial respiration experiments?

For rigorous assessment of recombinant ATPASE6 functional impact on mitochondrial respiration, a multi-parameter approach is recommended:

Table 1: Methodological Approaches for ATPASE6 Functional Assessment

For optimal results, researchers should implement these methods in parallel, as ATPASE6 dysfunction affects multiple aspects of mitochondrial function simultaneously. Control experiments should include known ATP synthase inhibitors (oligomycin) for comparison .

How do the unique mitochondrial introns in Metridium senile influence the expression and structure of recombinant ATPASE6?

The sea anemone Metridium senile possesses distinctive mitochondrial genomic features, notably the presence of group I introns in mitochondrial genes—a characteristic absent in most metazoan mitochondrial DNA. While these introns have been directly identified in cytochrome c oxidase subunit I (COI) and NADH dehydrogenase subunit 5 (ND5) genes, their influence extends to the expression of other mitochondrial genes including ATPASE6 .

• Expression systems must account for these unique splicing requirements when using genomic templates

• cDNA-based expression systems bypass splicing requirements but may not reflect natural post-transcriptional modifications

• Protein folding and function may be influenced by splicing-dependent RNA processing events

When designing expression vectors for Metridium senile ATPASE6, researchers should consider using codon-optimized synthetic genes that eliminate intronic sequences while preserving the critical amino acid sequence for functional studies .

What experimental protocols best demonstrate the relationship between ATPASE6 activity and mitochondrial dysfunction?

To investigate the relationship between ATPASE6 activity and mitochondrial dysfunction, researchers should implement a comprehensive experimental protocol that correlates protein activity with multiple indicators of mitochondrial function:

Step 1: Baseline Characterization

• Measure native ATPASE6 expression levels using quantitative RT-PCR

• Establish baseline mitochondrial function parameters using Seahorse XF Bioanalyzer

• Quantify basal ATP production using luciferase-based assays

Step 2: Experimental Manipulation

• Introduce recombinant ATPASE6 variants at different concentrations (0.1-10 μM)

• Apply selective inhibitors (oligomycin for comparison)

• Implement gene silencing approaches (siRNA) to reduce native ATPASE6 expression

Step 3: Functional Assessment

• Monitor changes in oxygen consumption rate (OCR) post-treatment

• Measure ATP production capacity following each intervention

• Assess mitochondrial membrane potential using JC-1 fluorescence

• Evaluate respiratory responses to sequential addition of FCCP and antimycin/rotenone

Step 4: Data Integration

• Correlate ATPASE6 expression/activity levels with functional parameters

• Analyze dose-dependent relationships between ATPASE6 manipulation and mitochondrial function

• Compare effects with other mitochondrial proteins (ND1-6, ND4L) to establish specificity

Research has demonstrated that ATPASE6 downregulation correlates strongly with decreased basal metabolic activity of mitochondria, impaired ATP synthesis, reduced maximal respiration, and diminished spare respiratory capacity. These effects manifest as concentration-dependent reductions in ATP production, establishing ATPASE6 as a critical determinant of mitochondrial OXPHOS capacity .

What are the critical quality control parameters for verifying recombinant Metridium senile ATPASE6 integrity prior to functional studies?

When preparing recombinant Metridium senile ATPASE6 for functional studies, implementing rigorous quality control measures is essential to ensure experimental reproducibility:

Purity Assessment:

• SDS-PAGE analysis should demonstrate >90% purity with expected molecular weight confirmation

• Mass spectrometry verification of intact protein mass (theoretical MW: approximately 25.5 kDa including His-tag)

• Absence of degradation products or aggregation confirmed by size exclusion chromatography

Structural Integrity:

• Circular dichroism spectroscopy to confirm secondary structure characteristics

• Tryptophan fluorescence spectroscopy to verify proper folding of hydrophobic domains

• Thermal shift assays to establish protein stability parameters

Functional Verification:

• ATPase activity assay using colorimetric phosphate detection methods

• Reconstitution into proteoliposomes to verify membrane integration capacity

• Proton transport measurement across artificial membranes

Research-grade recombinant ATPASE6 should maintain >80% of native activity with batch-to-batch variation less than 15% for reliable experimental outcomes. For storage stability assessment, activity measurements should be performed at regular intervals (fresh, 1 week, 1 month) under recommended storage conditions .

How can researchers distinguish between direct and indirect effects when studying ATPASE6 impact on mitochondrial respiration?

Distinguishing direct from indirect effects of ATPASE6 on mitochondrial respiration requires careful experimental design and appropriate controls:

Direct Effect Verification Protocol:

• Implement isolated mitochondria assays where purified recombinant ATPASE6 is directly incorporated into mitochondrial preparations

• Measure immediate changes in proton transport efficiency

• Conduct reconstitution experiments with purified components of respiratory chain complexes

• Perform crosslinking studies to identify direct protein-protein interactions with other respiratory chain components

Indirect Effect Control Methods:

• Time-course experiments to distinguish immediate (direct) from delayed (indirect) effects

• Parallel manipulation of known upstream and downstream pathway components

• Selective inhibition studies using specific blockers for each respiratory chain complex

• Gene expression profiling to identify compensatory mechanisms

Analytical Differentiation Approaches:

• Mathematical modeling of respiratory kinetics with and without ATPASE6 manipulation

• Factor analysis to separate primary and secondary effects on respiration

• Metabolic flux analysis to map changes in substrate utilization patterns

Research indicates that ATPASE6 exerts both direct effects on ATP synthesis (via immediate changes in proton transport efficiency) and indirect effects through altered expression of other mitochondrial genes in response to compromised ATP production. Distinguishing these temporally and mechanistically is crucial for accurate interpretation of experimental results .

What are the recommended controls for experiments investigating recombinant ATPASE6 effects on ATP production in cellular models?

For robust experimental design when investigating recombinant ATPASE6 effects on ATP production, the following control hierarchy is recommended:

Essential Control Conditions:

• Negative Controls:

  • Vehicle-only treatment matching reconstitution buffer composition

  • Heat-denatured ATPASE6 protein to control for non-specific protein effects

  • Non-related recombinant protein of similar size/structure

• Positive Controls:

  • Oligomycin (established ATP synthase inhibitor) at 0.5-2 μM

  • FCCP (mitochondrial uncoupler) at 0.25-1 μM

  • Antimycin/rotenone combination (electron transport chain inhibitors)

• Technical Controls:

  • Multiple cell lines to verify effects aren't cell-type specific

  • Concentration gradients to establish dose-dependency

  • Time-course measurements to distinguish acute vs. chronic effects

Validation Measurements:

Experimental observations should be benchmarked against established patterns where ATPASE6 downregulation correlates with diminished ATP production capacity, providing internal validation of experimental quality .

What emerging technologies show promise for investigating structure-function relationships in Metridium senile ATPASE6?

Several cutting-edge technologies are transforming research capabilities for ATPASE6 structure-function analysis:

• Cryo-electron Microscopy (Cryo-EM):

  • Enables visualization of ATPASE6 within the entire ATP synthase complex at near-atomic resolution

  • Allows investigation of conformational changes during proton translocation

  • Can reveal species-specific structural adaptations in Metridium senile ATPASE6

• AlphaFold2 and Structure Prediction:

  • Computational modeling of ATPASE6 structure based on amino acid sequence

  • Prediction of functional domains and critical residues

  • Comparative analysis with structures from other species

• Site-Directed Fluorescence Resonance Energy Transfer (FRET):

  • Real-time monitoring of conformational changes during ATP synthesis

  • Investigation of protein-protein interactions within the ATP synthase complex

  • Measurement of proton translocation dynamics

• Single-Molecule Techniques:

  • Direct observation of individual ATPASE6 molecules in artificial membranes

  • Measurement of proton conductance at the single-molecule level

  • Correlation of structure with function at unprecedented resolution

These technologies will enable researchers to address fundamental questions about the unique adaptations of Metridium senile ATPASE6 to its marine environment, potentially revealing novel mechanisms of energy conservation relevant to both basic science and biotechnological applications .

How does the genetic organization of Metridium senile mitochondrial DNA influence approaches to recombinant ATPASE6 expression?

The unique genetic architecture of Metridium senile mitochondrial DNA presents both challenges and opportunities for recombinant ATPASE6 expression:

Metridium senile mitochondrial DNA contains group I introns not found in other metazoan mtDNAs, specifically identified in genes for cytochrome c oxidase subunit I (COI) and NADH dehydrogenase subunit 5 (ND5) . These introns require specific processing mechanisms that may influence expression of mitochondrial proteins, including ATPASE6.

Expression Strategy Recommendations:

• Direct Genomic Amplification:

  • Requires consideration of intronic sequences

  • May necessitate co-expression of splicing factors

  • Presents challenges for heterologous expression systems

• cDNA-Based Expression:

  • Bypasses splicing requirements

  • Requires careful RNA isolation to capture properly processed transcripts

  • May miss regulatory elements embedded in intronic regions

• Synthetic Gene Approach:

  • Codon optimization for expression host

  • Elimination of intronic sequences

  • Optimization of critical structural elements

• Heterologous Tags and Fusion Strategies:

  • N-terminal His-tags facilitate purification without compromising function

  • Consider impact of tags on membrane insertion for this integral membrane protein

  • C-terminal modifications may interfere with critical functional domains

Research suggests that E. coli-based expression systems using synthetic genes with N-terminal His-tags provide the most consistent yields of functional protein, though mammalian cell expression systems may better recapitulate post-translational modifications relevant to function .

What computational approaches can predict functional impacts of mutations in Metridium senile ATPASE6?

Advanced computational methods offer powerful tools for predicting how mutations might affect ATPASE6 function:

Sequence-Based Prediction Methods:

• Multiple sequence alignment across evolutionary diverse species to identify conserved residues

• Position-specific scoring matrices to quantify conservation significance

• Machine learning algorithms trained on known functional mutations in ATP synthase components

Structure-Based Modeling Approaches:

• Homology modeling using resolved structures of ATP synthase subunit a from other species

• Molecular dynamics simulations to predict conformational changes caused by mutations

• Protein-protein docking to assess impacts on interactions with other ATP synthase components

Energy Calculation Methods:

• Free energy perturbation calculations to predict stability changes

• Electrostatic potential mapping to identify effects on proton translocation pathway

• Quantum mechanical/molecular mechanical (QM/MM) simulations for proton transfer energetics

Predicted Impact Assessment Framework:

These computational approaches can guide experimental design by prioritizing mutations for functional testing, potentially accelerating the discovery of structure-function relationships in Metridium senile ATPASE6 .

How does Metridium senile ATPASE6 compare structurally and functionally to homologous proteins in other marine organisms?

Comparative analysis reveals important differences between Metridium senile ATPASE6 and homologous proteins in other marine organisms:

Structural Comparison:

• Metridium senile ATPASE6 contains 229 amino acids, similar in length to other cnidarian homologs but shorter than vertebrate counterparts

• Contains distinctive hydrophobic domains essential for membrane insertion and proton channel formation

• Features cnidarian-specific motifs in the N-terminal region that may influence interaction with other ATP synthase components

Functional Adaptations:

• Marine invertebrates like Metridium senile have evolved ATP synthase components adapted to function optimally in fluctuating temperature environments

• Proton conductance pathways show modifications that may enable efficient energy production in seawater ionic conditions

• Regulatory mechanisms appear to differ from terrestrial organisms, potentially reflecting adaptation to osmotic challenges

Evolutionary Conservation Analysis:

• Core catalytic residues show high conservation across all kingdoms of life

• Membrane-spanning regions display cnidarian-specific adaptations

• Proton-binding sites reveal adaptations potentially related to the slightly alkaline marine environment

These comparative insights suggest that Metridium senile ATPASE6 represents an evolutionary adaptation to marine environments, with potential applications in understanding energy conversion mechanisms in variable environmental conditions .

What methodological considerations are important when comparing experimental results between recombinant and native ATPASE6?

When comparing experimental results between recombinant and native ATPASE6, researchers should consider several critical methodological factors:

Source Material Differences:

• Recombinant proteins typically contain affinity tags (His-tag) that may influence function

• Expression in prokaryotic systems (E. coli) lacks eukaryotic post-translational modifications

• Reconstituted membrane environments differ from native mitochondrial membranes

Experimental Design Adjustments:

• Include parallel experiments with tag-cleaved recombinant protein

• Compare multiple expression systems (bacterial, insect, mammalian)

• Standardize lipid composition in reconstitution experiments

• Normalize activity measurements to protein quantity using identical quantification methods

Validation Approaches:

• Structural comparison using circular dichroism and fluorescence spectroscopy

• Functional assessment in identical experimental conditions

• Side-by-side activity assays with consistent substrate concentrations

• Cross-validation using multiple functional endpoints (ATP production, proton transport)