Recombinant Metridium senile Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Description

Production and Characterization

Recombinant COII is synthesized in E. coli for research and biochemical studies. Two primary variants are documented:

Full-Length COII (His-Tagged)

  • Sequence: 1–248 amino acids (aa), including an N-terminal His-tag for purification .

  • Expression system: E. coli, with yields optimized via recombinant DNA technology .

Partial COII

  • Purity: >85% (SDS-PAGE verified) .

  • Storage:

    • Liquid form: 6 months at -20°C/-80°C.

    • Lyophilized form: 12 months at -20°C/-80°C .

ParameterFull-Length COIIPartial COII
TagN-terminal His-tagNot specified
Purity>85% (SDS-PAGE)>85% (SDS-PAGE)
Storage (liquid)6 months at -20°C/-80°C6 months at -20°C/-80°C
Source

Functional Relevance

COII plays a pivotal role in mitochondrial respiration, acting as a core subunit of COX complex IV. Its conservation across species highlights its essential role in electron transport :

  • Electron transfer: Facilitates the passage of electrons from cytochrome c to molecular oxygen, generating a proton gradient for ATP synthesis .

  • Evolutionary insights: Intraspecific variation in COII sequences (e.g., in Tigriopus californicus) suggests adaptive evolution to compensate for nuclear-encoded subunit substitutions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please inform us of any specific tag requirements for prioritized development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Metridium senile (Brown sea anemone) (Frilled sea anemone)
Target Names
COII
Target Protein Sequence
MTNLLNNWLIINQFGYDLPEPWQLGLQDAAHPVMEEIIFFHDQVMFILIIIITTVLWLIV KALSGKAYHRYLVDGTLLEIIWTIVPAIILILIAFPSLKLLYLMDEVMDPALTIKAIGHQ WYWSYEYSDYQTETLEFDSYMVPTSELNKGDFRLLEVDNRLVVPINTHVRVLVTGADVLH SFAVPALAVKMDAIPGRLNQTGFFIKRPGIFYGQCSEICGANHSFMPIVIEAVSLDKYIN WVLSGSDE
Uniprot No.

Target Background

Function

Recombinant Metridium senile Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This chain, comprising succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and CIV, facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. CIV catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the CuA center (subunit 2) and heme A (subunit 1) to the binuclear center (BNC) in subunit 1, comprised of heme A3 and CuB. The BNC uses four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Metridium senile Cytochrome c oxidase subunit 2 and what is its biological function?

Metridium senile Cytochrome c oxidase subunit 2 (COII) is a protein component of the cytochrome c oxidase complex found in the brown sea anemone. This protein is encoded by the COII gene located in the mitochondrial genome, which has been fully sequenced and determined to be 17.44 kilobases in length . Functionally, COII serves as a critical component of the electron transport chain in cellular respiration.

The complete amino acid sequence of Metridium senile COII consists of 248 amino acids with a characteristic structure that includes transmembrane regions designed to anchor the protein within the mitochondrial membrane .

How does recombinant Metridium senile COII differ from its native form?

Recombinant Metridium senile COII differs from its native form in several important ways:

  • Expression system: The recombinant protein is typically produced in bacterial, yeast, or insect cell systems rather than being extracted from sea anemone tissue. This allows for controlled production and higher yields.

  • Protein tags: Recombinant versions often include affinity tags (His-tag, FLAG-tag, etc.) that facilitate purification and detection but are not present in the native protein .

  • Post-translational modifications: Depending on the expression system used, the recombinant protein may lack some or all of the post-translational modifications present in the native protein.

  • Solubility: Recombinant proteins may be engineered for enhanced solubility through optimization of expression conditions and the addition of solubility-enhancing tags.

  • Storage stability: Commercial recombinant COII is typically formulated in buffers containing stabilizing agents like glycerol (50% as noted in product information) to maintain activity during storage .

FeatureNative COIIRecombinant COII
SourceMetridium senile tissueExpression system (E. coli, yeast, etc.)
PurityMixed with other cellular proteinsHigh purity after affinity purification
TagsNoneMay contain His-tag or other affinity tags
StorageNot applicable for research useTris-based buffer, 50% glycerol at -20°C
Post-translational modificationsAll natural modifications presentMay be absent or different

What experimental approaches are recommended for studying protein-protein interactions involving Metridium senile COII?

To investigate protein-protein interactions involving Metridium senile COII, researchers should consider the following methodological approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies specific to COII or its binding partners to pull down protein complexes, followed by Western blotting or mass spectrometry to identify interacting proteins.

  • Yeast two-hybrid screening: Employing COII as a bait protein to identify novel interaction partners from a cDNA library derived from Metridium senile or related species.

  • Surface Plasmon Resonance (SPR): For quantitative analysis of binding kinetics between COII and candidate interaction partners, allowing determination of association and dissociation constants.

  • Proximity Labeling: Techniques such as BioID or APEX, where COII is fused to a biotin ligase or peroxidase that biotinylates nearby proteins, enabling identification of the proximal proteome.

  • Molecular Docking: Computational approaches similar to those used in vaccine design studies can predict interaction interfaces between COII and other proteins. The Cluspro 2.0 server has been successfully employed for similar analyses with sea anemone proteins .

When working with recombinant COII, it's crucial to consider how the presence of affinity tags might affect protein-protein interactions. Control experiments comparing tagged and untagged versions of the protein or using different tag positions (N-terminal vs. C-terminal) can help address this concern.

How can codon optimization enhance the expression of recombinant Metridium senile COII in heterologous systems?

Codon optimization is a critical strategy for improving the expression of Metridium senile COII in heterologous systems. Based on approaches used for similar sea anemone proteins, the following methodological considerations are important:

  • Host-specific codon bias: The genetic code is redundant, with multiple codons encoding the same amino acid. Different organisms show preferences for certain codons, known as codon bias. For optimal expression, the COII gene sequence should be adapted to match the codon usage preferences of the expression host.

  • Codon Adaptation Index (CAI): The Java Codon Adaptation Tool (JCat) can be used to optimize codon usage. A CAI value close to 1.0 indicates optimal codon usage. For example, optimization of sea anemone protein expression in E. coli K12 has achieved CAI values of 0.99 .

  • GC content adjustment: Optimizing the GC content to around 50% can improve mRNA stability and translation efficiency. In similar sea anemone protein studies, GC content of 50.25% has been achieved through codon optimization .

  • Removal of regulatory sequences: Eliminating sequences that might interfere with expression, such as internal Shine-Dalgarno sequences, cryptic splice sites, or premature termination codons.

  • Vector selection: Choosing an appropriate expression vector compatible with the optimized sequence. For instance, successful cloning of sea anemone proteins has been achieved using the pET-21c(+) vector with a C-terminal His-tag .

The following data illustrates the potential impact of codon optimization on Metridium senile protein expression parameters:

ParameterBefore OptimizationAfter Optimization
Codon Adaptation Index (CAI)0.60-0.70 (typical)0.99
GC ContentVariable/suboptimal50.25%
Predicted Expression LevelLow-moderateHigh
Inclusion Body FormationLikely higherReduced (predicted value: 0.806)

What are the optimal conditions for maintaining the stability and activity of recombinant Metridium senile COII?

Maintaining the stability and activity of recombinant Metridium senile COII requires careful attention to storage and handling conditions. Based on product information and general principles for recombinant proteins, the following methodological recommendations apply:

  • Storage temperature: Store the protein at -20°C for general use, with -80°C recommended for extended storage periods .

  • Buffer composition: The optimal buffer for COII stability is a Tris-based buffer containing 50% glycerol, specifically formulated to maintain the protein's native conformation .

  • Freeze-thaw cycles: Repeated freezing and thawing should be avoided as this can lead to protein denaturation and activity loss. Working aliquots should be prepared and stored at 4°C for up to one week .

  • Additive considerations:

    • Reducing agents (DTT or β-mercaptoethanol) may be necessary to maintain redox-sensitive sites

    • Protease inhibitors to prevent degradation during experimental procedures

    • Metal ions (particularly copper) may be required for maintaining the active site structure

  • pH optimization: The theoretical isoelectric point (pI) of sea anemone proteins in similar studies has been determined to be around 8.06 , suggesting that buffer pH should be maintained away from this value to ensure solubility.

For activity assays, the following stability parameters should be considered:

ParameterOptimal ConditionNotes
Temperature range4-37°CActivity assays typically at 25-30°C
pH range7.0-8.0Based on similar mitochondrial proteins
Recommended storage-20°C (short term)
-80°C (long term)
In 50% glycerol
Working concentrationApplication dependentTypically 0.1-1 mg/ml
Estimated half-life1 hour (mammalian reticulocytes)
30 min (yeast in vivo)
10 hours (E. coli in vivo)
Based on similar proteins

What considerations are important when designing experiments to study the enzymatic activity of recombinant Metridium senile COII?

When designing experiments to study the enzymatic activity of recombinant Metridium senile COII, researchers should address the following methodological considerations:

  • Assay selection: Cytochrome c oxidase activity can be measured through:

    • Spectrophotometric assays monitoring the oxidation of reduced cytochrome c

    • Oxygen consumption measurements using oxygen electrodes

    • Polarographic techniques to detect electron transfer rates

  • Reconstitution requirements: As a membrane protein complex component, COII may require reconstitution with other subunits or incorporation into liposomes to exhibit native-like activity.

  • Cofactor inclusion: Ensure the presence of necessary cofactors:

    • Copper ions (Cu2+) essential for catalytic activity

    • Heme groups that may be required for electron transfer

  • Substrate preparation: Reduced cytochrome c must be freshly prepared to prevent auto-oxidation. This typically involves reduction with ascorbate or sodium dithionite followed by separation of excess reductant.

  • Controls and standards:

    • Positive controls using commercial cytochrome c oxidase

    • Negative controls using heat-inactivated enzyme

    • Inhibitor controls using specific cytochrome c oxidase inhibitors (e.g., potassium cyanide, azide)

  • Reaction conditions optimization:

    • Temperature range testing (typically 25-37°C)

    • pH optimization (usually pH 7.0-7.5)

    • Ionic strength adjustments

  • Data analysis approaches:

    • Initial velocity measurements for kinetic parameters

    • Lineweaver-Burk or Eadie-Hofstee plots for Km and Vmax determination

    • Hill plots to assess cooperative binding if present

The following table outlines a suggested experimental design framework:

Experimental ParameterRecommended ApproachConsiderations
Enzyme concentration0.01-0.5 μMDetermine linear range of activity
Substrate concentration1-100 μM reduced cytochrome cShould span at least 0.2-5× Km
Temperature25°C (standard)
4-37°C (range testing)
Effect on stability vs. activity
pH7.2 (standard)
6.0-8.5 (range testing)
Buffer system must not interfere
Time course0-10 minutesEnsure linear reaction phase
Data collectionAbsorbance at 550 nm
Oxygen consumption
Multiple timepoints for accuracy

How can structural and functional studies of Metridium senile COII contribute to understanding evolutionary adaptations in cnidarian mitochondrial proteins?

Structural and functional studies of Metridium senile COII can provide valuable insights into evolutionary adaptations of mitochondrial proteins in cnidarians through the following methodological approaches:

  • Comparative sequence analysis: The recently sequenced genome of Metridium senile provides an excellent foundation for comparative genomics . Researchers should:

    • Align COII sequences across diverse cnidarian species

    • Identify conserved domains versus rapidly evolving regions

    • Calculate selection pressures (dN/dS ratios) to identify sites under positive selection

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM to determine the three-dimensional structure

    • Homology modeling based on related proteins when experimental structures are unavailable

    • Analysis of structural features unique to cnidarian COII compared to other metazoans

  • Functional assays across environmental gradients:

    • Testing enzymatic activity across temperature ranges relevant to cnidarian habitats

    • Evaluating pH tolerance compared to COII from terrestrial organisms

    • Assessing oxygen affinity adaptations relevant to marine environments

  • Molecular evolutionary rate analysis:

    • Comparing evolutionary rates of COII versus nuclear-encoded respiratory complex components

    • Examining the correlation between COII evolution and ecological niches within cnidarians

    • Investigating coevolution patterns between interacting mitochondrial proteins

  • Ancestral sequence reconstruction:

    • Inferring ancestral COII sequences at key evolutionary junctures

    • Expressing and characterizing these reconstructed proteins to understand functional shifts

M. senile's genome characteristics provide context for these evolutionary studies:

Genomic FeatureMetridium senile ValueRelevance to Evolutionary Studies
Genome size390.9 megabases Context for gene duplication events
Mitochondrial genome17.44 kilobases Compact compared to nuclear genome
Chromosomal structure16 chromosomes Synteny analysis with other cnidarians
BUSCO completeness96.6% High-quality reference for comparative studies
GC content35.0-38.0% Potential adaptation to marine environment

As M. senile has a circumboreal distribution that overlaps with nearly every other species in the genus Metridium , comparative studies of COII across populations could reveal important adaptations to different temperature regimes and environmental conditions.

What approaches can be used to assess the immunogenic properties of Metridium senile COII for vaccine development or diagnostic applications?

Assessing the immunogenic properties of Metridium senile COII for potential vaccine development or diagnostic applications requires a multi-faceted approach, drawing on methods similar to those used for other sea anemone proteins:

  • Epitope prediction and validation:

    • In silico epitope prediction using tools like IEDB analysis resource server to identify MHC-I (CTL) and MHC-II (HTL) binding epitopes

    • Validation of predicted epitopes through synthetic peptide binding assays

    • Assessment of epitope conservation across Metridium species variants

  • Structural analysis for accessible epitopes:

    • Tertiary structure prediction using Swiss-Model server

    • Structure validation with tools like ANOLEA, PROS, and Verify3D

    • Identification of surface-exposed regions likely to be recognized by the immune system

  • Immunoinformatics workflow:

    • Design of multi-epitope constructs linking identified epitopes with appropriate linkers

    • Addition of adjuvant sequences to enhance immunogenicity

    • Molecular docking with immune receptors (e.g., TLR4) using tools like Cluspro 2.0

    • Binding affinity prediction with servers like Prodigy

  • Immunization studies (in silico followed by in vivo):

    • Immune response simulation using C-ImmSim server to predict vaccination outcomes

    • Animal model studies to validate predicted immune responses

    • Analysis of antibody titers, T-cell responses, and protection efficacy

  • Physiochemical property analysis:

    • Assessment of stability parameters including instability index, aliphatic index, and GRAVY values

    • Prediction of protein half-life in different systems (mammalian, yeast, E. coli)

    • Solubility assessment to ensure viable formulation

Based on similar studies with sea anemone proteins, the following properties might be expected for a COII-based vaccine construct:

PropertyPredicted ValueSignificance
Molecular weight~130 kDaSimilar to other multi-epitope constructs
Isoelectric point (pI)~8.0Slightly basic character
Instability index<40 (stable)Values below 40 indicate stability
Aliphatic index~70Indicator of thermostability
GRAVYNegative valueIndicates hydrophilic nature, favorable for solubility
Secondary structure~29% α-helix, ~20% extended strand, ~51% random coilTypical distribution for immunogenic proteins
Inclusion bodies prediction<0.9Suggests good expression without toxicity to host cells

How can researchers address challenges in purifying active recombinant Metridium senile COII?

Purifying active recombinant Metridium senile COII presents several challenges that researchers can address through the following methodological strategies:

  • Optimizing expression conditions:

    • Temperature modulation: Lower temperatures (16-20°C) during induction often improve folding of membrane proteins

    • Induction optimization: Testing various IPTG concentrations (0.1-1.0 mM) and induction times (3-24 hours)

    • Co-expression with chaperones: Including molecular chaperones like GroEL/GroES or DnaK/DnaJ/GrpE to assist proper folding

    • Specialized expression strains: Using E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression

  • Solubilization and extraction approaches:

    • Detergent screening: Testing multiple detergents (DDM, LDAO, OG, etc.) at various concentrations

    • Solubilization buffer optimization: Including glycerol (10-20%) and salt (100-500 mM NaCl) to stabilize the protein

    • Extraction time and temperature: Generally, 1-2 hours at 4°C with gentle agitation

  • Purification strategy refinement:

    • Multi-step purification: Combining affinity chromatography with size exclusion and/or ion exchange steps

    • On-column refolding: Gradually removing denaturants while the protein is bound to the affinity resin

    • Adding stabilizing cofactors: Including copper ions and potentially heme groups during purification

  • Activity preservation techniques:

    • Buffer composition: Tris-based buffers with 50% glycerol for storage, as indicated in product information

    • Avoiding freeze-thaw cycles: Preparing single-use aliquots

    • Reconstitution approaches: Incorporating purified protein into liposomes or nanodiscs to maintain native-like environment

  • Validation of proper folding:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Fluorescence spectroscopy to examine tertiary structure

    • Limited proteolysis to verify compact folding

Purification ChallengeRecommended StrategyExpected Outcome
Inclusion body formationLower induction temperature to 16°C; use 0.1-0.3 mM IPTGIncreased proportion of soluble protein
Low binding to affinity resinEnsure tag accessibility; try both N- and C-terminal tag positionsImproved capture efficiency
Loss of activity during purificationAdd stabilizing agents (glycerol, specific lipids, Cu2+ ions)Preservation of enzymatic function
Aggregation after purificationInclude mild detergents or reconstitute into lipid nanoparticlesMaintained protein stability
Contaminant co-purificationImplement stringent washing steps and secondary purification methodsEnhanced purity

What strategies can help resolve inconsistent results in functional assays involving recombinant Metridium senile COII?

When encountering inconsistent results in functional assays involving recombinant Metridium senile COII, researchers should implement the following methodological troubleshooting strategies:

  • Protein quality assessment:

    • Verify protein integrity through SDS-PAGE and Western blotting

    • Check for degradation products using mass spectrometry

    • Assess protein homogeneity via size exclusion chromatography

    • Confirm proper folding using spectroscopic methods

  • Assay standardization:

    • Implement rigorous positive and negative controls in each experimental batch

    • Use internal standards to normalize between experiments

    • Calibrate equipment regularly (spectrophotometers, electrodes, etc.)

    • Standardize reagent preparation, particularly reduced cytochrome c

  • Critical parameter control:

    • Maintain consistent temperature during assays (±0.5°C)

    • Monitor and control pH precisely

    • Use freshly prepared buffers and substrate solutions

    • Implement strict timing protocols for all assay steps

  • Data analysis refinement:

    • Apply appropriate statistical tests for outlier detection

    • Use regression analysis to identify variables significantly affecting outcomes

    • Consider Bayesian approaches for complex datasets

    • Implement blinding procedures when possible

  • Systematic variable testing:

    • Create a matrix of test conditions varying one parameter at a time

    • Document all experimental conditions meticulously

    • Analyze batch-to-batch variation in protein preparations

    • Investigate potential interfering factors in assay components

Common IssuePotential CauseResolution Strategy
Variable baseline activityInconsistent protein qualityImplement stricter quality control; use single protein preparation for comparative studies
Non-reproducible kineticsSubstrate auto-oxidationPrepare fresh substrate immediately before assays; control oxygen levels
Activity loss over timeProtein instabilityAdd stabilizing agents; maintain consistent temperature; minimize handling time
Inconsistent inhibition resultsVariable inhibitor qualityUse certified reference standards; create standard inhibition curves
Batch-to-batch variationExpression/purification differencesStandardize all production parameters; pool batches when possible

How can computational modeling be used to predict the impact of mutations on the structure and function of Metridium senile COII?

Computational modeling provides powerful tools for predicting how mutations might affect the structure and function of Metridium senile COII. Researchers can implement the following methodological approaches:

  • Homology modeling and structural prediction:

    • Generate a 3D structural model using Swiss-Model or similar tools, as applied for other sea anemone proteins

    • Validate model quality with ANOLEA, PROS, and Verify3D servers

    • Refine the model through molecular dynamics simulations

    • Map conserved functional domains and catalytic residues

  • Mutation effect prediction pipelines:

    • Employ PROVEAN, PolyPhen-2, or SIFT to predict functional impacts of mutations

    • Use FoldX or Rosetta for energy calculations to assess structural stability changes

    • Apply molecular dynamics simulations to evaluate dynamic effects of mutations

    • Implement ensemble approaches combining multiple prediction algorithms

  • Protein-protein interaction modeling:

    • Use docking tools like Cluspro 2.0 to model interactions between wild-type or mutant COII and partner proteins

    • Calculate binding energy differences with tools like Prodigy Server

    • Analyze interface contacts using LigPlot+ or similar tools to identify critical interaction residues

    • Simulate the dynamics of protein complexes to understand allosteric effects

  • Evolutionary conservation analysis:

    • Apply ConSurf or similar tools to map evolutionary conservation onto the structural model

    • Identify sites under positive or negative selection pressure

    • Compare conservation patterns across mitochondrial proteins in cnidarians

    • Correlate evolutionary rates with structural and functional domains

  • Integration with experimental validation:

    • Design site-directed mutagenesis experiments based on computational predictions

    • Create targeted libraries of variants for high-throughput functional screening

    • Develop prediction-guided activity assays focusing on specific aspects of COII function

    • Establish feedback loops between computational and experimental approaches

Computational MethodApplicationExpected Outcome
Homology modelingGenerating 3D structureFoundation for structure-function analysis
Molecular dynamicsSimulating protein flexibilityDynamic behavior of wild-type and mutant proteins
Energy calculationsAssessing stability changesΔΔG values predicting destabilizing mutations
Conservation mappingIdentifying critical residuesPrioritization of functionally important sites
Docking simulationsModeling protein-protein interactionsBinding interface analysis and affinity predictions
Electrostatic surface mappingUnderstanding charge distributionInsights into substrate binding and specificity

By integrating these computational approaches with targeted experimental validation, researchers can develop a comprehensive understanding of structure-function relationships in Metridium senile COII and predict how specific mutations might affect its role in cellular respiration.

How might the study of Metridium senile COII contribute to understanding mitochondrial evolution in early-branching metazoans?

The study of Metridium senile COII offers unique opportunities to explore mitochondrial evolution in early-branching metazoans through several methodological approaches:

  • Phylogenomic analysis:

    • The fully sequenced genome (390.9 megabases) and mitochondrial genome (17.44 kilobases) of Metridium senile provide valuable data for comparative genomics

    • Integration of COII sequence data into broader phylogenetic frameworks can help resolve evolutionary relationships among cnidarians

    • Analysis of selection pressures acting on COII compared to other mitochondrial genes can reveal evolutionary constraints

  • Comparative structural biology:

    • Structural comparisons between cnidarian COII and homologs from other metazoan lineages can identify lineage-specific adaptations

    • Analysis of functional domains conserved across all metazoans versus those unique to early-branching lineages

    • Investigation of how structural features relate to environmental adaptations in marine versus terrestrial organisms

  • Mitochondrial genome architecture analysis:

    • Examination of gene order and synteny in the mitochondrial genome of Metridium senile compared to other metazoans

    • Analysis of regulatory elements and non-coding regions that may influence COII expression

    • Investigation of potential lateral gene transfer events in mitochondrial evolution

  • Functional evolution studies:

    • Biochemical characterization of recombinant COII from diverse cnidarian species to identify functional differences

    • Resurrection studies using ancestral sequence reconstruction to test hypotheses about functional shifts during evolution

    • Comparison of enzymatic parameters (Km, kcat, substrate specificity) across evolutionary lineages

  • Environmental adaptation analysis:

    • Correlation of COII sequence features with habitat parameters across M. senile's circumboreal distribution

    • Investigation of temperature adaptation mechanisms in mitochondrial proteins from cold-water cnidarians

    • Assessment of oxygen affinity adaptations in marine versus freshwater cnidarian species

Evolutionary AspectMethodological ApproachExpected Insight
Sequence divergenceMolecular clock analysisTiming of evolutionary events in mitochondrial evolution
Structural conservation3D structure comparisonCore functional elements preserved across metazoan evolution
Functional adaptationEnzyme kinetics across lineagesSelection pressures acting on respiratory function
Gene orderMitochondrial genome mappingGenomic rearrangements during cnidarian evolution
Environmental selectionPopulation genetics across habitatsAdaptive evolution in response to environmental factors
Coevolution patternsCorrelation analysis with nuclear genesCoordinated evolution of mitochondrial complexes

As M. senile has broad geographic distribution that overlaps with nearly every other species in the genus , it provides an excellent model for studying how mitochondrial proteins adapt to different environmental conditions while maintaining core functionality.

What are the prospects for using recombinant Metridium senile COII in biotechnological applications?

Recombinant Metridium senile COII offers several promising avenues for biotechnological applications, which can be explored through these methodological approaches:

  • Biocatalysis applications:

    • Evaluation of COII as a potential biocatalyst for oxidation reactions in industrial processes

    • Assessment of stability under non-physiological conditions (temperature, pH, organic solvents)

    • Engineering COII variants with enhanced stability or altered substrate specificity

    • Immobilization techniques for continuous biocatalytic processes

  • Biosensor development:

    • Integration of COII into electrochemical biosensors for oxygen detection

    • Development of cytochrome c-based biosensors for monitoring electron transfer processes

    • Creation of inhibitor screening platforms for environmental toxin detection

    • Coupling COII reactions with signal amplification systems for improved sensitivity

  • Therapeutic and diagnostic applications:

    • Evaluation of COII-derived peptides as potential therapeutic agents

    • Development of diagnostic tools based on COII epitopes

    • Creation of chimeric vaccine constructs combining COII epitopes with adjuvants

    • Exploration of COII as a model for studying mitochondrial dysfunction in human diseases

  • Protein engineering approaches:

    • Directed evolution of COII for enhanced stability or altered function

    • Rational design based on structural insights to create specialized variants

    • Creation of fusion proteins combining COII with reporter proteins or targeting domains

    • Expression optimization using codon adaptation strategies similar to those employed for other sea anemone proteins

  • Educational and research tools:

    • Development of COII-based experimental kits for teaching mitochondrial function

    • Creation of standardized assay systems for comparative studies

    • Use as a model system for protein expression and purification training

Biotechnological ApplicationKey RequirementsDevelopment Strategy
BiocatalysisStability enhancementDirected evolution; immobilization techniques
Biosensor platformsSignal transduction optimizationElectrode coupling; nanoparticle integration
Diagnostic toolsEpitope identification and validationEpitope mapping; antibody development
Vaccine componentsImmunogenicity assessmentMulti-epitope design with appropriate linkers and adjuvants
Protein engineering templatesStructural characterizationStructure-guided mutations; domain swapping

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.