Recombinant Metridium senile NADH-ubiquinone oxidoreductase chain 3 (ND3)

What is Metridium senile NADH-ubiquinone oxidoreductase chain 3 (ND3)?

NADH-ubiquinone oxidoreductase chain 3 (ND3) is a mitochondrial protein component of complex I in the electron transport chain. In Metridium senile (brown sea anemone or frilled sea anemone), ND3 is a 118-amino acid protein that functions in cellular respiration. The protein is encoded by the ND3 gene and is also known as NADH dehydrogenase subunit 3 . As a component of the mitochondrial respiratory chain, it plays a critical role in energy metabolism within sea anemone cells.

The full amino acid sequence of Metridium senile ND3 is: MYTEFYGILVLLIFSVVLSAIISGASYILGDKQPDREKVSAYECGFDPFGTPGRPFSIRF FLIGILFLIFDLEISFLFPWCVVCNQVFPFGYWTMIVFLAVLTLGLVYEWLKGGLEWE . This sequence information is crucial for researchers designing experiments involving this protein, particularly for structural and functional studies.

How is recombinant Metridium senile ND3 expressed and purified for research applications?

Recombinant Metridium senile ND3 is typically expressed in E. coli expression systems. The full-length (1-118 amino acids) protein is commonly expressed with an N-terminal His tag to facilitate purification . The His-tagged fusion protein allows for efficient isolation through metal affinity chromatography techniques.

For purification of recombinant peptides from Metridium senile, a standard approach involves:

• Expression in E. coli BL21(DE3) cells

• Isolation of the fusion protein by metal affinity chromatography

• Cleavage of the fusion protein (if needed)

• Purification by reverse-phase HPLC

• Verification of proper folding and molecular weight by co-injection with native peptide on reverse-phase column and mass spectrometry

When working with recombinant Metridium senile proteins, researchers should verify proper folding and biological activity through appropriate assays to ensure the recombinant protein mimics the native form's functions.

What are the optimal storage and handling conditions for recombinant Metridium senile ND3?

For optimal preservation of recombinant Metridium senile ND3 protein activity and stability, researchers should follow these evidence-based protocols:

Prior to reconstitution, the lyophilized powder form of the protein should be briefly centrifuged to ensure all material is at the bottom of the vial. After reconstitution, proper aliquoting is essential to prevent degradation from repeated freeze-thaw cycles .

What experimental approaches are used to characterize the functionality of Metridium senile ND3?

Characterizing the functionality of Metridium senile ND3 and related proteins requires multiple complementary approaches:

• Gene Expression Analysis: Amplification of cDNAs using RACE (Rapid Amplification of cDNA Ends) methods with degenerate primers designed from conserved regions of the protein. The 3'- and 5'-RACE techniques can be employed using total RNA from Metridium senile as a template, with specific primers designed for the target gene .

• Protein Structure Determination: The disulfide bridge arrangement in peptides from Metridium senile can be determined through partial reduction, alkylation, and mass spectrometry analysis. This is particularly important for peptides like Ms 9a-1 from the same organism, whose structural features affect their bioactivity .

• Functional Assays: For bioactive peptides from this organism, functional assays may include:

  • Fluorescent inflow calcium assays on stable cell lines expressing target receptors

  • Patch-clamp electrophysiology to measure effects on ion channels

  • In vivo testing in mouse models for analgesic and anti-inflammatory effects

• Verification of Recombinant Protein Identity: Methods include:

  • Mass spectrometry to confirm molecular weight

  • N-terminal sequencing via Edman degradation

  • Co-injection with native peptide on reverse-phase HPLC

  • Assessment of retention time to verify proper folding

These methodological approaches provide complementary data on both structural and functional aspects of Metridium senile proteins.

How can researchers optimize expression systems for Metridium senile ND3?

Optimization of expression systems for Metridium senile ND3 requires attention to several parameters:

• Expression Vector Selection: For His-tagged recombinant ND3, vectors with strong promoters like T7 are commonly employed for E. coli expression systems . For peptides from the same organism, fusion proteins with thioredoxin have shown good results .

• Expression Host Selection: While E. coli BL21(DE3) is the standard expression host for Metridium senile proteins , researchers may need to explore specialized strains for proteins that:

  • Contain multiple disulfide bonds

  • Show toxicity to standard E. coli strains

  • Require specific post-translational modifications

• Induction Conditions: Optimization of:

  • IPTG concentration

  • Induction temperature (often lowered to 16-25°C for improved folding)

  • Induction duration

• Protein Extraction and Purification:

  • For His-tagged ND3, metal affinity chromatography followed by size-exclusion chromatography

  • For peptides requiring disulfide bond formation, controlled oxidative folding conditions

  • Cleavage of fusion tags with appropriate proteases or chemical methods like CNBr

• Yield Enhancement: For peptides from Metridium senile, yields of approximately 2.4 mg/liter of cell culture have been reported . Researchers can improve this through:

  • Optimization of cell density at induction

  • Media composition adjustment

  • Codon optimization for E. coli expression

Each of these parameters should be systematically optimized for the specific construct being expressed.

What research applications does recombinant Metridium senile ND3 and related peptides have in pain and inflammation studies?

Metridium senile has yielded bioactive peptides with significant potential in pain and inflammation research. While ND3 itself is a mitochondrial protein, peptides like Ms 9a-1 from the same organism show promising bioactivity:

• TRPA1 Modulation: Ms 9a-1, a 35-amino acid peptide from Metridium senile, acts as a positive modulator of TRPA1 (Transient Receptor Potential Ankyrin-repeat 1), an important player in pain and inflammatory pathways . This modulation makes it valuable for studying:

  • Pain signal transduction mechanisms

  • TRPA1 structure-function relationships

  • Development of novel analgesic compounds

• Antinociceptive Effects: Despite potentiating TRPA1 in vitro, Ms 9a-1 produces significant antinociceptive effects when administered in vivo (0.3 mg/kg intravenous injection), reducing the response to TRPA1 agonists . This apparent contradiction provides a valuable research model for understanding complex pain modulation pathways.

• Anti-inflammatory Properties: Ms 9a-1 has demonstrated reverse effects on CFA (Complete Freund's Adjuvant) induced inflammation , suggesting potential applications in:

  • Inflammatory disease models

  • Development of novel anti-inflammatory therapeutics

  • Understanding of neuro-immune interactions

• Structure-Function Studies: Analysis of structural determinants of peptides like Ms 9a-1 that are essential for bioactivity can provide insights into the design of novel therapeutics targeting pain and inflammation pathways .

These applications position Metridium senile-derived compounds as valuable research tools in pain and inflammation studies, potentially leading to novel therapeutic approaches.

How can the consecutive controlled case series (CCCS) design be applied to Metridium senile ND3 research?

The consecutive controlled case series (CCCS) design offers a sophisticated methodological approach that could be valuable for Metridium senile ND3 research, particularly when studying its derived bioactive peptides in therapeutic applications:

This methodological approach would be particularly valuable for translational research on Metridium senile-derived bioactive compounds moving from pre-clinical to clinical applications.

What structural determinants of peptides from Metridium senile are essential for bioactivity?

Understanding the structural determinants of peptides from Metridium senile is crucial for structure-function relationships and rational drug design:

• Disulfide Bridge Arrangement: The 35-amino acid Ms 9a-1 peptide contains two disulfide bridges that are critical for its three-dimensional structure and bioactivity . The specific arrangement of these bridges creates a β-hairpin motif similar to other sea anemone peptides in structural group 9a.

• Genetic Diversity and Variation: Analysis of Ms 9a-1 has revealed two different genes (ms9.1 and ms9.2) encoding precursor proteins containing the target peptide . This genetic diversity suggests that:

  • Non-synonymous substitutions

  • Domain recombination

  • Other gene mutations in precursor genes

  may be responsible for functional differences between related peptides from Metridium senile .

• Sequence-Activity Relationships: The differences between Ms 9a-1 and related peptides appear to be essential for TRPA1 potentiation . Researchers investigating these relationships should consider:

  • Positively charged residues that may interact with negatively charged receptor surfaces

  • Hydrophobic residues forming the core of the peptide

  • Surface-exposed amino acids that directly interact with target receptors

• Maturation Sequences: The precursor proteins for Ms 9a-1 contain maturation sequences that can be removed by dipeptidyl peptidases, a feature common to sea anemone, hymenoptera, and amphibian toxins . This post-translational processing is likely critical for bioactivity.

By systematically analyzing these structural determinants, researchers can develop a deeper understanding of the molecular mechanisms underlying the bioactivity of Metridium senile peptides, potentially leading to the design of novel peptide-based therapeutics.

What flow chamber experimental designs are appropriate for studying Metridium senile biology?

When studying Metridium senile biology in laboratory settings, appropriate flow chamber designs are crucial for mimicking natural conditions:

• Flume Design Parameters: Laboratory flumes for Metridium senile studies should be designed with:

  • Sufficient length (≥300 cm) to establish stable flow patterns

  • Flow straighteners at the entrance to reduce turbulence

  • Precise flow control using invertible propellers or similar mechanisms

  • Water depth of approximately 18-20 cm to accommodate anemone morphology

• Flow Velocity Considerations: Research has demonstrated that different size classes of Metridium senile have different optimal flow regimes for processes like prey capture:

  • Small anemones: Lower flow velocities (optimal around 4-10 cm/s)

  • Large anemones: Higher flow velocities (efficient at 10-17 cm/s)

• Experimental Setup: Researchers should consider:

  • Positioning of specimens relative to flow direction

  • Spatial arrangement when studying interactions between multiple specimens

  • Acclimation period before measurements to allow for complete tentacle-crown extension

  • Control of prey density and distribution within the water column

• Measurement Approaches: For feeding studies, researchers should standardize:

  • Prey type (e.g., Artemia salina nauplii, approximately 600 μm in length)

  • Method for quantifying capture rates (per polyp, per cm² of tentacle-crown area, or per gram of ash-free dry weight)

  • Duration of feeding experiments

When designed properly, these laboratory systems can effectively mimic the natural flow environments experienced by Metridium senile, enabling controlled studies of feeding ecology, morphological plasticity, and other biological processes.

How can researchers validate proper folding and bioactivity of recombinant Metridium senile proteins?

Validating proper folding and bioactivity of recombinant Metridium senile proteins requires multiple complementary approaches:

• Physicochemical Validation:

  • Co-injection with native peptide on reverse-phase HPLC column to compare retention times

  • Mass spectrometry to confirm molecular weight matches theoretical predictions

  • Circular dichroism spectroscopy to assess secondary structure elements

  • NMR spectroscopy for detailed structural analysis when feasible

• Functional Validation:

  • For TRPA1-modulating peptides like Ms 9a-1: fluorescent inflow calcium assays on stable CHO cell lines expressing the receptor

  • Electrophysiological recordings (patch-clamp) to directly measure effects on ion channel activity

  • Comparison of dose-response curves between recombinant and native proteins

• In Vivo Validation:

  • Assessment of biological activity in appropriate animal models

  • For analgesic peptides: testing effects on nociceptive and inflammatory responses to established agonists

  • Comparison of pharmacokinetic and pharmacodynamic profiles between recombinant and native proteins

• Structural Validation:

  • Verification of disulfide bridge formation through partial reduction and alkylation

  • N-terminal sequencing of at least 5 amino acid residues to confirm identity

  • Assessment of oligomeric state through size-exclusion chromatography or light scattering

The combined results from these validation approaches provide comprehensive evidence for proper folding and bioactivity of recombinant Metridium senile proteins, ensuring the reliability of subsequent experimental findings.

What are common challenges in expressing recombinant Metridium senile proteins in E. coli systems?

Researchers working with recombinant Metridium senile proteins often encounter several challenges in E. coli expression systems:

• Codon Usage Bias: Marine invertebrate genes often contain codons that are rare in E. coli, potentially leading to:

  • Premature termination of translation

  • Reduced expression levels

  • Misincorporation of amino acids

  Solution: Codon optimization of the gene sequence for E. coli expression or use of strains containing additional tRNAs for rare codons.

• Disulfide Bond Formation: Peptides like Ms 9a-1 contain multiple disulfide bonds crucial for proper folding and activity. The reducing environment of E. coli cytoplasm can impede correct disulfide bond formation .

  Solution:

  • Expression as fusion proteins with thioredoxin or other solubility-enhancing tags

  • Directing expression to the periplasmic space where disulfide bond formation is favored

  • Use of E. coli strains with enhanced disulfide bond formation capabilities (e.g., Origami, SHuffle)

• Protein Toxicity: Some marine peptides may be toxic to E. coli host cells, limiting yield.

  Solution:

  • Use of tightly controlled inducible expression systems

  • Lowering induction temperature (16-20°C)

  • Reducing inducer concentration

  • Expression as inactive fusion proteins requiring post-translational activation

• Protein Insolubility: Membrane proteins like ND3 often form inclusion bodies when overexpressed .

  Solution:

  • Optimization of induction conditions (temperature, inducer concentration, duration)

  • Co-expression with chaperones

  • Use of solubility-enhancing fusion tags

  • Development of refolding protocols from inclusion bodies

• Low Yield: Typical yields of approximately 2.4 mg/liter for Metridium senile peptides may be insufficient for extensive research applications.

  Solution:

  • Scale-up of culture volumes

  • High-density fermentation techniques

  • Optimization of media composition

  • Exploration of alternative expression hosts

Systematic optimization of these parameters is essential for successful expression of functional recombinant Metridium senile proteins.

How can researchers distinguish between methodological artifacts and genuine biological effects when studying Metridium senile ND3?

Distinguishing between methodological artifacts and genuine biological effects requires rigorous experimental design and multiple validation approaches:

• Appropriate Controls:

  • Negative controls: Empty vector, inactive protein variants, or irrelevant proteins of similar size

  • Positive controls: Well-characterized proteins with known activities

  • Vehicle controls: All buffers and additives without the protein of interest

  • Concentration gradients: Demonstrating dose-dependent effects

• Cross-Validation Approaches:

  • Use of multiple, orthogonal assay methods to confirm observations

  • Comparison between recombinant and native proteins

  • In vitro to in vivo translation of findings

  • Replication in independent laboratory settings

• Addressing Specific Artifacts:

  • Tag interference: Compare tagged vs. untagged proteins or use multiple tag positions

  • Endotoxin contamination: Include endotoxin testing and removal procedures

  • Buffer components: Systematic testing of buffer components for independent effects

  • Expression host contaminants: Rigorous purification and validation

• Statistical Considerations:

  • Appropriate sample sizes based on power calculations

  • Blinding of analysts where possible

  • Use of statistical methods appropriate for the data distribution

  • Implementation of CCCS design elements for more robust generalizations

• Paradoxical Effects Resolution:

  • The apparent contradiction between Ms 9a-1's in vitro potentiation of TRPA1 and in vivo analgesic effects highlights the importance of:

    • Testing across multiple models and systems

    • Considering indirect effects and compensatory mechanisms

    • Examining effects at multiple time points

    • Investigating potential off-target interactions

By implementing these approaches, researchers can increase confidence that observed effects represent genuine biological phenomena rather than methodological artifacts.

What emerging research approaches could advance our understanding of Metridium senile ND3 and related peptides?

Several emerging research approaches hold promise for advancing our understanding of Metridium senile ND3 and related peptides:

• Cryo-Electron Microscopy (Cryo-EM): High-resolution structural studies of ND3 within the context of the complete mitochondrial complex I could provide insights into:

  • Structural adaptations specific to marine invertebrates

  • Functional interactions between subunits

  • Conformational changes during electron transport

• CRISPR/Cas9 Gene Editing: Development of gene editing tools for Metridium senile could enable:

  • Generation of knockout or knockdown models

  • Introduction of point mutations to test structure-function hypotheses

  • Creation of reporter constructs for in vivo visualization

• Single-Cell Transcriptomics: Application to Metridium senile tissues could reveal:

  • Cell-type specific expression patterns of ND3 and related genes

  • Developmental regulation of expression

  • Responses to environmental stressors

• Peptidomics and Proteomics:

  • Comprehensive profiling of the Metridium senile peptidome

  • Identification of novel bioactive peptides related to Ms 9a-1

  • Characterization of post-translational modifications

• Computational Approaches:

  • Molecular dynamics simulations of ND3 and Ms 9a-1

  • Machine learning prediction of structure-activity relationships

  • Systems biology modeling of mitochondrial function

• Translational Research:

  • Development of peptide mimetics based on Ms 9a-1 structure

  • Testing in pre-clinical pain and inflammation models

  • Application of CCCS design for clinical translation

These approaches, particularly when combined, could significantly advance our understanding of Metridium senile proteins and their potential applications in basic research and therapeutic development.

How might evolutionary analysis of Metridium senile ND3 inform our understanding of mitochondrial protein evolution?

Evolutionary analysis of Metridium senile ND3 offers valuable insights into mitochondrial protein evolution across diverse taxa:

• Phylogenetic Analysis:

  • Comparison of ND3 sequences across cnidarians and other metazoan lineages

  • Identification of conserved domains suggesting functional importance

  • Detection of lineage-specific accelerated evolution

  • Mapping of selection pressures on specific residues or protein regions

• Structural Evolution:

  • Analysis of how transmembrane domains have evolved while maintaining function

  • Identification of co-evolving residues that maintain structural integrity

  • Comparison with homologous proteins from species adapted to different environments

• Functional Adaptation:

  • Investigation of adaptations related to the sea anemone's unique ecology:

    • Temperature adaptation (cold-water tolerance)

    • Oxidative stress resistance

    • Energy efficiency in variable flow environments

• Horizontal Gene Transfer Assessment:

  • Evaluation of potential ancient horizontal gene transfer events

  • Analysis of unusual sequence features that might indicate gene transfer

  • Comparison with bacterial homologs

• Endosymbiotic Theory Insights:

  • As a mitochondrial protein, ND3 evolution provides a window into the evolution of the endosymbiotic relationship

  • Comparison with alpha-proteobacterial homologs

  • Analysis of nuclear versus mitochondrial genetic control

These evolutionary analyses could inform our understanding of:

• Fundamental mechanisms of mitochondrial protein evolution

• Adaptation of energy metabolism to marine environments

• Conservation of essential protein functions across diverse lineages

• Potential targets for bioinspired design of novel proteins or therapeutic agents