Recombinant Metridium senile NADH-ubiquinone oxidoreductase chain 4L (ND4L)

What is Metridium senile NADH-ubiquinone oxidoreductase chain 4L (ND4L)?

ND4L is a mitochondrially-encoded subunit of Complex I (NADH dehydrogenase) of the electron transport chain. In Metridium senile, it consists of 99 amino acids and functions as part of the first and largest enzyme complex in the respiratory chain. This complex serves as a proton pump and is a significant contributor to cellular energy production through oxidative phosphorylation. The protein has the UniProt ID O47492 and plays an essential role in the mitochondrial function of this sea anemone species .

What is the amino acid sequence of Metridium senile ND4L?

The full amino acid sequence of Metridium senile ND4L (positions 1-99) is:
MYYRYMIVAILLLLLGVLGIVLNRGHLIIMLMSIELILLAASFLFLINSMITDTLIEQVFTIMVLTVAAAESSIGLAIMVAYYRIKGTIAIKSLNWLRG

This hydrophobic protein contains multiple transmembrane domains that anchor it within the inner mitochondrial membrane, allowing it to participate in electron transport and proton pumping activities.

How does Metridium senile ND4L differ from ND4L in other organisms?

Metridium senile ND4L shows specific adaptations that may relate to the marine environment and evolutionary history of sea anemones. Comparative genomic analyses indicate that mitochondrial genes in sea anemones generally undergo constrained selection pressure to maintain their functions, with a calculated ω (dN/dS) ratio of 0.08316 for mitochondrial protein-coding genes in the order Actiniaria. This suggests strong purifying selection, particularly in species from extreme environments like deep-sea habitats .

How should recombinant Metridium senile ND4L be reconstituted for experimental use?

For optimal reconstitution of lyophilized recombinant Metridium senile ND4L:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is recommended)

• Aliquot for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles

The reconstituted protein should be handled carefully as repeated freezing and thawing can compromise protein integrity. Working aliquots may be stored at 4°C for up to one week .

What buffer conditions are optimal for experiments with recombinant Metridium senile ND4L?

The recombinant protein is typically provided in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0. This buffer formulation helps maintain protein stability. For storage after reconstitution, the addition of 50% glycerol is recommended to prevent protein denaturation during freeze-thaw cycles .

What techniques can be used to verify the purity and integrity of recombinant Metridium senile ND4L?

SDS-PAGE is the primary recommended application for analyzing recombinant Metridium senile ND4L. The protein typically shows greater than 90% purity as determined by SDS-PAGE analysis. Additional techniques that may be employed include:

• Western blotting using anti-His antibodies to detect the N-terminal His-tag

• Mass spectrometry to confirm protein mass (expected ~4.6 kDa plus tag)

• Circular dichroism (CD) spectroscopy to assess secondary structure integrity

• Size exclusion chromatography to evaluate aggregation states

How can Metridium senile ND4L be used to study mitochondrial adaptations to marine environments?

Metridium senile ND4L offers a valuable model for investigating mitochondrial adaptations to marine environments. Research approaches may include:

• Comparative analysis with ND4L from terrestrial organisms to identify marine-specific adaptations

• Site-directed mutagenesis of key residues to assess their role in protein function and environmental adaptation

• Functional assays measuring electron transport efficiency under varying salinity, temperature, and pressure conditions to mimic marine environments

• Integration with proteomic analyses of the entire Complex I to understand subunit interactions specific to marine invertebrates

Studies on similar proteins in deep-sea species have revealed adaptive evolution of the NADH dehydrogenase complex, with evidence of both purifying selection and occasional positive selection at specific sites that may influence the efficiency of the electron transport chain under extreme conditions .

What role does Metridium senile ND4L play in reactive oxygen species (ROS) generation and how can this be experimentally assessed?

The NADH dehydrogenase complex containing ND4L is a major source of reactive oxygen species in mitochondria and significantly contributes to cellular oxidative stress. To investigate ROS production:

• Isolate mitochondria from cells expressing recombinant ND4L or native tissue

• Measure ROS production using fluorescent probes (e.g., MitoSOX Red, DCF-DA)

• Compare ROS production under various conditions (hypoxia, temperature stress, pH variations)

• Assess the impact of specific inhibitors on ROS generation

• Evaluate antioxidant system responses when ND4L activity is modulated

Research suggests that adaptations in the NADH dehydrogenase complex may help organisms balance energy production with oxidative stress management, particularly in challenging environments like the deep sea where efficient energy utilization is crucial .

How does Metridium senile ND4L transcription and processing occur in mitochondria?

Mitochondrial gene expression in cnidarians like Metridium senile exhibits unique characteristics. ND4L may be part of polycistronic transcription units, where multiple genes are transcribed as a single RNA molecule before being processed into mature mRNAs. Based on studies in related cnidarians:

• ND4L might be co-transcribed with other NADH dehydrogenase subunits (such as ND3-ND4-mtMutS or ND2-ND5-ND4 units observed in octocorals)

• Processing of these polycistronic messages likely occurs without the use of tRNA punctuation commonly seen in other organisms

• Mature mRNAs may contain untranslated regions (UTRs) of varied lengths at the 5' and 3' ends

• Alternative polyadenylation could play a regulatory role in gene expression

These transcriptional characteristics make Metridium senile mitochondrial genes, including ND4L, interesting models for studying RNA processing mechanisms in early-branching metazoans.

What are common challenges when working with recombinant Metridium senile ND4L and how can they be addressed?

Recombinant hydrophobic membrane proteins like ND4L present several challenges:

• Protein Aggregation: Due to its hydrophobic nature, ND4L may aggregate during storage or experimental handling

  • Solution: Include mild detergents (0.1% Triton X-100 or 0.5% CHAPS) in working buffers

• Low Solubility: Membrane proteins often show limited solubility in aqueous solutions

  • Solution: Use specialized membrane protein solubilization buffers containing appropriate detergents

• Protein Degradation: Proteolytic degradation may occur during storage or experiments

  • Solution: Add protease inhibitors to all buffers and maintain proper cold chain management

• Activity Loss: Function may be compromised during purification or reconstitution

  • Solution: Validate protein activity using functional assays comparing native and recombinant proteins

How can evolutionary analysis of Metridium senile ND4L inform research on mitochondrial adaptations?

Evolutionary analysis of Metridium senile ND4L can yield valuable insights through:

How can Metridium senile ND4L research contribute to broader understanding of sea anemone biology?

Research on Metridium senile ND4L can contribute to broader understanding through:

• Bioenergetic Adaptations: Analysis of ND4L function can reveal how sea anemones adapt their energy metabolism to marine conditions

  • Compare respiratory chain efficiency between Metridium senile and other cnidarians from different habitats

• Evolution of Mitochondrial Genomes: Studying ND4L gene organization and expression provides insights into mitochondrial genome evolution in early-branching metazoans

  • Metridium senile mitochondrial transcription shows unique patterns compared to other animals

• Connection to Venom Production: While ND4L itself is not a venom component, energy metabolism supported by respiratory chain proteins is crucial for venom peptide synthesis

  • Metridium senile produces novel peptides with nAChR binding activity that have unique structural features including an inhibitor cystine knot (ICK) fold

By integrating ND4L research with broader studies of sea anemone biology, researchers can develop a more comprehensive understanding of how these ancient animals have adapted to their environments at the molecular level.

How does the structure and function of Metridium senile ND4L compare with homologs from other marine invertebrates?

Comparative analysis can reveal evolutionary conservation and divergence patterns:

• Structural Comparison: The 99 amino acid sequence of Metridium senile ND4L can be aligned with homologs from other cnidarians and marine invertebrates to identify conserved transmembrane domains and functional motifs

  • Hydrophobicity plots and transmembrane domain predictions can highlight structural adaptations specific to sea anemones

• Functional Conservation: Despite sequence variations, the core function in electron transport is typically conserved

  • Experimental approaches using complementation assays in model systems can test functional equivalence

• Taxonomic Analysis: Comparison with other cnidarians can inform phylogenetic relationships and evolutionary history

  • The evolutionary rate of ND4L appears slower in deep-sea species, suggesting stability of deep marine environments over evolutionary time

What emerging technologies could advance research on Metridium senile ND4L?

Several cutting-edge approaches hold promise for future research:

• Cryo-Electron Microscopy: High-resolution structural characterization of the entire NADH dehydrogenase complex containing ND4L

  • This would provide insights into subunit interactions and functional mechanisms

• CRISPR/Cas9 Technology: Development of gene editing systems for cnidarians could enable functional studies through targeted mutations

  • In vivo studies of ND4L variants would advance understanding of structure-function relationships

• Single-Cell Transcriptomics: Analysis of cell-type specific expression patterns in different tissues of Metridium senile

  • This could reveal specialized functions in different cell populations

• Proteomics Approaches: Identification of post-translational modifications and protein-protein interactions

  • Techniques like BioID or proximity labeling could map the interactome of ND4L within the mitochondrial membrane

Current research suggests that understanding mitochondrial adaptations in marine invertebrates may have broader implications for bioenergetics and evolutionary biology, making Metridium senile ND4L an important model for future investigations.