Recombinant Metridium senile NADH-ubiquinone oxidoreductase chain 6 (ND6)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant ND6 is synthesized in E. coli systems, optimized for high-yield expression and stability:

  • Expression System: E. coli BL21 or similar strains .

  • Purification Method: Affinity chromatography using nickel-NTA resin (His tag) .

  • Purity: >85–90% (verified by SDS-PAGE) .

  • Storage: Lyophilized powder or glycerol-containing buffer at -20°C/-80°C to prevent degradation .

Critical Notes:

  • Repeated freeze-thaw cycles destabilize the protein; aliquoting is recommended .

  • Reconstitution in Tris/PBS-based buffers with 6% trehalose enhances solubility .

Role in Complex I Assembly

ND6 is essential for the structural integrity of Complex I’s membrane arm. Studies in mammalian cells show that ND6 mutations disrupt the assembly of mitochondrial DNA-encoded subunits, reducing NADH:Q1 oxidoreductase activity by >99% . In Metridium senile, ND6’s hydrophobic domains likely anchor the complex within the mitochondrial inner membrane .

Metabolic Consequences of ND6 Deficiency

  • Loss of ND6 abolishes malate/glutamate-driven respiration by ~90% .

  • Cells lacking functional ND6 fail to grow in galactose media, indicating defective oxidative phosphorylation .

Research Applications

Recombinant ND6 is primarily used to study:

  1. Mitochondrial Disorders: Modeling mutations linked to Leigh syndrome and other Complex I deficiencies .

  2. Evolutionary Biology: Comparing ND6 sequences across species to trace mitochondrial genome adaptations .

  3. Drug Development: Screening inhibitors or modulators of electron transport chain activity .

Limitations:

  • Not suitable for human therapeutic use due to potential immunogenicity .

  • Requires functional validation in eukaryotic systems (e.g., yeast or mammalian mitochondria) .

Comparative Analysis

ND6 vs. Other Complex I Subunits:

FeatureND6Nuclear-Encoded Subunits
Genomic OriginMitochondrial DNANuclear DNA
Assembly RoleCritical for membrane arm stabilityPeripheral arm assembly
Mutation ImpactSevere respiratory chain dysfunctionVariable, often tissue-specific

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize developing the specified tag.
Synonyms
ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Metridium senile (Brown sea anemone) (Frilled sea anemone)
Target Names
ND6
Target Protein Sequence
MVTMYFFTLSFGTVASGIMVISALNPVHSVFWLVVAFISSAALFILLGVDFIALMFIIIY VGAIAILFLFVIMMLNLTDFTPAFRRGGEADMTNYVPIGLAVGTLFFEAIASSWLIMGGP YVYRGLLGAWDLANPWFLKKYHNIEAIGRILYTDCYYLFILVSFILLVAMLGAIVLTQEI GTEIGPTAKKQDIFVQTSRAQV
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly required for catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How does the genetic code of Metridium senile ND6 differ from other invertebrates?

The mitochondrial genetic code of Metridium senile ND6 exhibits several distinctive features compared to other invertebrates. In M. senile mitochondrial protein genes, the codons AGA and AGG specify arginine (following the standard genetic code) rather than serine as would be expected in other invertebrate mitochondrial genetic codes. Additionally, the codon ATA specifies isoleucine according to the standard genetic code. The TGA codon appears in three M. senile mitochondrial protein genes and likely specifies tryptophan, as is common in other metazoan, protozoan, and some fungal mitochondrial genetic codes . These genetic code variations must be carefully considered when designing recombinant expression systems, particularly when using prokaryotic or eukaryotic expression vectors that may interpret these codons differently.

What functional role does ND6 play in the respiratory chain of Metridium senile?

NADH-ubiquinone oxidoreductase chain 6 (ND6) is an essential component of Complex I (NADH dehydrogenase) in the mitochondrial electron transport chain. This complex functions as the first and largest enzyme complex of the respiratory chain, serving as a critical proton pump. Complex I is also recognized as a major source of reactive oxygen species (ROS) in mitochondria and significantly contributes to cellular oxidative stress management . In sea anemones like Metridium senile, the ND6 protein likely plays a crucial role in energy metabolism adaptation to marine environments. Understanding the functional characteristics of recombinant ND6 can provide insights into the bioenergetic adaptations of cnidarians and contribute to broader knowledge about respiratory chain evolution across metazoan lineages.

What are the optimal expression systems for producing functional recombinant Metridium senile ND6?

The expression of functional recombinant Metridium senile ND6 presents several technical challenges that must be addressed through careful selection of expression systems. Based on the unique genetic code features of M. senile mitochondrial DNA, researchers should consider codon-optimized constructs when expressing this protein in standard prokaryotic or eukaryotic systems. For membrane proteins like ND6, cell-free expression systems supplemented with lipid nanodiscs or detergent micelles may provide advantages for maintaining proper folding and functionality.

Alternatively, specialized eukaryotic systems such as insect cells (Sf9 or High Five) using baculovirus expression vectors may offer a more native-like membrane environment. When designing expression constructs, researchers should incorporate appropriate affinity tags (His6, FLAG, or Strep-II) positioned to minimize interference with protein folding and function. Expression trials should systematically evaluate protein yield, solubility, and functional activity across multiple expression conditions while monitoring for potential toxicity to the host cells, which is common when expressing membrane proteins of the electron transport chain.

How can researchers address the challenges of purifying recombinant ND6 while maintaining its native conformation?

Purification of recombinant Metridium senile ND6 requires specialized approaches to maintain the native conformation of this integral membrane protein. A recommended purification protocol would include:

  • Membrane fraction isolation using differential centrifugation following cell lysis

  • Detergent screening to identify optimal solubilization conditions (commonly testing DDM, LMNG, or CHAPS)

  • Immobilized metal affinity chromatography (IMAC) as an initial purification step

  • Size exclusion chromatography to remove aggregates and improve homogeneity

The choice of detergent is particularly critical for ND6 purification, as inappropriate detergents can disrupt protein structure and function. The table below summarizes detergent options and their applications for ND6 purification:

DetergentCMC (mM)Applications for ND6AdvantagesLimitations
DDM0.17Initial extractionMild, widely usedMay not preserve all activities
LMNG0.01Purification, crystallizationEnhanced stabilityHigher cost
Digitonin0.5Functional studiesPreserves supercomplexesLimited stability
SMA copolymerN/ANative nanodisc formationPreserves lipid environmentpH limitations

Researchers should validate the structural integrity of purified recombinant ND6 using circular dichroism spectroscopy and assess functionality through activity assays measuring NADH oxidation rates or membrane potential generation in reconstituted systems.

What methodological approaches can be used to study the interaction of recombinant ND6 with other subunits of Complex I?

Studying interactions between recombinant Metridium senile ND6 and other subunits of Complex I requires sophisticated biochemical and biophysical approaches. Co-immunoprecipitation studies using tagged versions of ND6 and potential interacting partners can identify direct protein-protein interactions. For more detailed analysis, researchers can employ:

  • Chemical crosslinking coupled with mass spectrometry (XL-MS) to map interaction interfaces

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) to determine binding kinetics and affinities

  • Co-expression systems where multiple complex I subunits are simultaneously produced

  • Cryo-electron microscopy of partially assembled complexes to visualize structural integration

What structural features distinguish Metridium senile ND6 from homologs in other species?

The structural features of Metridium senile ND6 show several distinctive characteristics compared to homologs in other species. While detailed structural data specifically for M. senile ND6 is limited in the current literature, comparative analysis based on mitochondrial genome sequencing suggests unique attributes. The mitochondrial genes of M. senile, including ND6, reflect evolutionary divergence that occurred after the Cnidarian lineage separated from the ancestral line common to other metazoa . This evolutionary distance likely manifests in structural variations within the transmembrane domains and connecting loops of the ND6 protein.

Analysis of codon usage patterns suggests potential differences in amino acid composition compared to other metazoan ND6 proteins, particularly at sites using the codons AGA and AGG (which specify arginine in M. senile but serine in other invertebrates) . These amino acid substitutions could significantly impact protein folding, stability, and functional interactions within Complex I. Researchers working with recombinant M. senile ND6 should employ comparative homology modeling incorporating these unique sequence features to predict structural elements that may require special consideration during expression and purification.

How can site-directed mutagenesis of recombinant ND6 help identify functionally critical residues?

Site-directed mutagenesis of recombinant Metridium senile ND6 provides a powerful approach to identifying functionally critical residues involved in proton pumping, ubiquinone binding, and subunit interactions. A systematic mutagenesis strategy should target:

  • Conserved residues in transmembrane domains that may participate in proton translocation

  • Residues at predicted interfaces with other Complex I subunits

  • Regions showing evidence of adaptive evolution unique to cnidarians

  • Residues potentially involved in ubiquinone binding and electron transfer

When designing a mutagenesis study, researchers should prioritize the following mutation types:

Mutation TypeRationaleExpected OutcomeAnalysis Method
Alanine scanningRemoves side chain interactionsIdentifies essential residuesActivity assays
Conservative substitutionsMaintains similar propertiesConfirms specific interactionsKinetic analysis
Charge reversalDisrupts electrostatic interactionsReveals charged interaction networksAssembly analysis
Cysteine introductionAllows crosslinking and labelingMaps proximity relationshipsCrosslinking studies

Functional characterization of mutants should combine activity measurements (NADH:ubiquinone oxidoreductase activity) with structural assessments (protease sensitivity patterns, accessibility studies) and assembly analysis (BN-PAGE) to comprehensively evaluate the impact of each mutation on protein function and complex integrity.

What enzymatic assays are most appropriate for assessing recombinant Metridium senile ND6 activity?

The functional characterization of recombinant Metridium senile ND6 requires specialized enzymatic assays that can assess activity within the context of Complex I function. Since ND6 alone does not possess the complete enzymatic activity of Complex I, researchers must either incorporate it into partially assembled complexes or assess specific aspects of its function. The following assays are recommended:

  • NADH:ubiquinone oxidoreductase activity assay - This measures electron transfer from NADH to ubiquinone analogs (such as decylubiquinone or coenzyme Q1) and can be monitored spectrophotometrically at 340 nm (NADH oxidation) or with artificial electron acceptors like ferricyanide.

  • Proton translocation measurements - Reconstituting recombinant ND6 with other Complex I subunits into proteoliposomes allows assessment of proton pumping activity using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine).

  • ROS production assays - Since Complex I is a major source of reactive oxygen species, measuring superoxide or hydrogen peroxide production using indicators such as Amplex Red can provide insights into electron leakage during catalysis.

  • Inhibitor sensitivity profiling - Comparing the sensitivity of reconstituted complexes containing recombinant ND6 to known Complex I inhibitors (rotenone, piericidin A, DQA) can reveal functional integrity of the ubiquinone binding site and electron transfer pathway.

When performing these assays, researchers should establish appropriate controls including measurements with inhibitors to confirm specificity and comparisons with native Complex I to benchmark activity levels.

How does recombinant ND6 contribute to understanding the adaptive evolution of NADH dehydrogenase in marine environments?

Recombinant Metridium senile ND6 serves as a valuable model for investigating the adaptive evolution of NADH dehydrogenase in marine environments. The NADH dehydrogenase complex plays a crucial role in energy metabolism adaptation to environmental conditions. In hadal and abyssal zones, organisms must adapt their energy metabolism to extreme conditions, and changes in ND components, including ND6, may influence the efficiency of the NADH dehydrogenase complex .

Comparative functional studies using recombinant ND6 from M. senile and other marine species can reveal adaptive modifications that optimize energy production under varying environmental pressures. Key aspects to investigate include:

  • Thermal stability profiles across temperature ranges relevant to the organism's habitat

  • Salt and pressure tolerance of enzymatic activity

  • Efficiency of electron transfer and proton pumping under varying oxygen concentrations

  • ROS production rates under stress conditions

These functional characteristics can be correlated with specific amino acid substitutions to identify molecular signatures of adaptation. Such studies contribute to our broader understanding of how fundamental bioenergetic processes evolve in response to environmental challenges, particularly in marine invertebrates that inhabit diverse ecological niches ranging from shallow coastal waters to deep-sea environments.

How does the expression pattern of ND6 in Metridium senile compare to other cnidarians?

The expression pattern of ND6 in Metridium senile compared to other cnidarians provides important evolutionary context for mitochondrial genome evolution. While specific expression data for M. senile ND6 is limited in the current literature, comparative analysis can be conducted through RNA-Seq approaches and qRT-PCR validation. Researchers investigating this question should design experiments that examine:

  • Tissue-specific expression patterns across different body regions of M. senile (tentacles, column, pedal disc)

  • Developmental regulation throughout the life cycle

  • Expression responses to environmental stressors (temperature, pH, oxygen levels)

  • Comparative expression across related cnidarian species

The unusual structure of the M. senile mitochondrial genome, where all genes are transcribed from the same strand , suggests potential for polycistronic transcription and coordinated expression of mitochondrial genes. This organization differs from that found in other metazoans and warrants investigation of unique regulatory mechanisms. Studies of recombinant ND6 expression should be complemented by analyses of native gene expression patterns to provide a comprehensive understanding of ND6 regulation in the context of mitochondrial function and cnidarian physiology.

What insights can comparative analysis of recombinant ND6 from different cnidarians provide about mitochondrial evolution?

Comparative analysis of recombinant ND6 from different cnidarians can yield significant insights into mitochondrial evolution and the diversification of energy metabolism pathways. The mitochondrial genome of Metridium senile exhibits several unique features compared to other metazoans, suggesting that many of the unusual characteristics of metazoan mitochondrial genetic codes, rRNAs, and tRNAs developed after divergence of the Cnidarian line from the ancestral line common to other metazoa .

To explore these evolutionary questions, researchers should consider:

  • Expressing recombinant ND6 from multiple cnidarian species representing different evolutionary lineages

  • Comparing functional parameters (catalytic efficiency, stability, inhibitor sensitivity)

  • Conducting phylogenetic analyses incorporating structural and functional data

  • Identifying lineage-specific adaptations versus conserved features

The table below outlines a comparative framework for analyzing ND6 across cnidarian lineages:

Analytical ApproachParameters to CompareEvolutionary Insights
Sequence analysisAmino acid composition, conservation patternsSelection pressures on specific domains
Structural modelingTransmembrane topology, binding interfacesStructural constraints during evolution
Functional assaysEnzymatic efficiency, environmental toleranceAdaptive functional modifications
Protein-protein interactionsSubunit binding patterns, assembly kineticsCo-evolution of interacting components

This comparative approach can reveal how mitochondrial proteins like ND6 have evolved within cnidarians while maintaining essential functions in energy metabolism, potentially identifying unique adaptations that contribute to the ecological success of these organisms across diverse marine environments.

How can structural studies of recombinant Metridium senile ND6 inform drug discovery targeting mitochondrial dysfunction?

Structural studies of recombinant Metridium senile ND6 can provide valuable insights for drug discovery efforts targeting mitochondrial dysfunction. While M. senile is evolutionarily distant from humans, the fundamental mechanisms of mitochondrial electron transport are conserved across metazoa, making comparative structural analysis informative for understanding human Complex I. The unique features of M. senile ND6 may reveal alternative conformational states or functional mechanisms not readily apparent in mammalian systems.

Researchers can leverage recombinant M. senile ND6 for:

  • Comparative binding site analysis to identify conserved pockets that could serve as targets for broad-spectrum mitochondrial modulators

  • Cryo-EM structural studies of assembled or partially assembled complexes, potentially revealing conformational states difficult to capture in mammalian systems

  • Fragment-based screening against stabilized ND6 to identify novel chemical scaffolds that interact with this highly hydrophobic protein

  • Structure-based design of peptides that mimic critical interaction interfaces within Complex I

These approaches can contribute to the development of therapeutic strategies for mitochondrial disorders, particularly those involving Complex I dysfunction. The evolutionary distance between cnidarians and mammals provides an opportunity to identify both conserved functional elements that may be essential across all metazoa and divergent features that could inform species-selective interventions.

What potential biotechnological applications exist for engineered variants of recombinant ND6?

Engineered variants of recombinant Metridium senile ND6 offer several intriguing biotechnological applications beyond basic research into mitochondrial function. Potential applications include:

  • Biosensors for environmental monitoring: Engineered ND6 variants with modified sensitivity to environmental toxicants could serve as the basis for biosensors detecting mitochondrial inhibitors in marine environments.

  • Bioenergy applications: Understanding the unique properties of M. senile ND6 could inform the design of more efficient or robust electron transport systems for biofuel cells or artificial photosynthesis platforms.

  • Protein engineering platforms: The distinct evolutionary characteristics of cnidarian mitochondrial proteins make them valuable templates for protein engineering efforts aimed at creating novel functions or enhanced stability.

  • Biomedical research tools: Labeled or modified recombinant ND6 could serve as probes for studying mitochondrial membrane dynamics or as screening tools for compounds affecting mitochondrial function.

When developing these applications, researchers should consider structure-function relationships unique to M. senile ND6 and exploit these features to address specific technological challenges. The natural adaptation of this protein to marine environments may confer properties such as salt tolerance or stability under variable conditions that could be valuable in biotechnological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.