Recombinant Meyerozyma guilliermondii Altered inheritance of mitochondria protein 11 (AIM11)

What is Meyerozyma guilliermondii and why is it relevant as an expression host?

Meyerozyma guilliermondii is a yeast species that has gained attention as an alternative expression host for recombinant proteins. This organism was initially isolated from traditional food starters such as 'ragi' from Malaysia, demonstrating its food-grade safety profile . M. guilliermondii has become scientifically relevant due to its potential to overcome limitations present in conventional yeast expression systems. Unlike some established yeast hosts, M. guilliermondii strain SMB shows no native lipase activity (when tested at both 30°C and 70°C), making it particularly suitable for the expression of exogenous lipases without background interference . Additionally, its natural resistance profile allows for effective selection using Hygromycin B (50 μg/mL) as a marker .

What is the Altered Inheritance of Mitochondria Protein 11 (AIM11) and what cellular functions does it perform?

The Altered Inheritance of Mitochondria Protein 11 (AIM11) belongs to a class of proteins involved in mitochondrial inheritance and function. While specific information about M. guilliermondii AIM11 is limited in the literature, studies on homologous proteins in related species such as Zygosaccharomyces rouxii indicate that AIM11 consists of 145 amino acids with the sequence beginning with "MNNVQFSERQISAFSHEYKIRRKRQMLRFFCATALTLVSCRVAYRGMLGRKYIPNMFQLN" and continuing through the protein . Structurally, AIM11 appears to contain transmembrane domains consistent with its role in mitochondrial membrane functions. Research suggests that AIM11 and related proteins may participate in maintaining mitochondrial integrity during cell division and influence organelle segregation during budding in yeast species.

What expression vectors are most effective for recombinant protein production in M. guilliermondii?

For the effective expression of recombinant proteins in M. guilliermondii, vectors containing the formaldehyde dehydrogenase promoter (PFLD1) have demonstrated significant success . The pFLDhα vector, which was developed by modifying a Komagataella phaffii (formerly Pichia pastoris) expression vector, has shown particular promise. This modification involved replacing the sh ble gene (conferring Zeocin resistance) with the hyg gene (conferring Hygromycin B resistance) . This adaptation is critical since Hygromycin B at 50 μg/mL has proven to be an effective selection marker for M. guilliermondii strain SMB. The vector includes a secretion signal that facilitates protein export from the cell, which can significantly simplify downstream purification processes.

What are the optimal growth conditions for M. guilliermondii recombinant strains?

Based on research with M. guilliermondii strain SMB, optimal growth and expression conditions include:

These conditions have been established for expressing thermostable lipase from Bacillus sp. L2 and may require optimization for AIM11 expression . The reduced induction time represents a significant advantage over other yeast expression systems, potentially increasing laboratory throughput and reducing production costs.

How can experimental design approaches be applied to optimize recombinant AIM11 expression in M. guilliermondii?

Optimizing recombinant AIM11 expression in M. guilliermondii benefits significantly from multivariate statistical experimental design methodologies. Unlike traditional univariate approaches that test one variable at a time, multivariate designs allow researchers to:

• Simultaneously evaluate multiple parameters affecting expression

• Identify statistically significant variables

• Detect important interactions between variables

• Characterize experimental error with greater precision

• Gather high-quality data with fewer experiments

When applying these approaches to AIM11 expression, researchers should employ factorial or fractional factorial designs to investigate key variables such as temperature, pH, induction timing, inducer concentration, and media composition. For example, a 2^5-1 fractional factorial design would require only 16 experiments to evaluate five factors at two levels each, while maintaining statistical orthogonality .

The response variables should include both total protein yield and the proportion of soluble, functionally active AIM11. Analysis of variance (ANOVA) can then identify the most influential factors and their interactions, leading to the development of a predictive model for optimizing expression conditions. This approach has successfully increased soluble expression of other recombinant proteins to levels exceeding 250 mg/L .

What strategies can address protein misfolding and inclusion body formation when expressing AIM11 in heterologous systems?

Protein misfolding and inclusion body formation represent significant challenges when expressing mitochondrial membrane proteins like AIM11. Several evidence-based strategies can mitigate these issues:

For AIM11 specifically, the transmembrane domains present particular challenges. Expression strategies that have proven successful for other mitochondrial membrane proteins include using specialized detergent-containing buffers during extraction and purification to maintain protein solubility and native conformation.

How can researchers differentiate between native and recombinant AIM11 when conducting functional studies?

Differentiating between native and recombinant AIM11 in functional studies requires careful experimental design and appropriate controls:

• Epitope tagging: The addition of epitope tags (His, FLAG, HA) to recombinant AIM11 enables specific detection using commercial antibodies. For example, the His-tagged AIM11 approach used with Z. rouxii AIM11 could be adapted for M. guilliermondii. Western blotting with anti-His antibodies can then specifically detect the recombinant protein.

• Genetic knockouts: Generating AIM11 knockout strains provides an essential negative control for functional studies. Complementation with the recombinant version can then confirm functional equivalence.

• Subcellular fractionation: Mitochondrial isolation coupled with proteomic analysis can identify both native and recombinant AIM11 based on mass differences resulting from epitope tags.

• Immunofluorescence microscopy: Antibodies against epitope tags can visualize the localization of recombinant AIM11, while antibodies against conserved AIM11 regions can detect both native and recombinant forms.

• Functional assays: Quantitative assays measuring mitochondrial inheritance or membrane potential can assess whether recombinant AIM11 restores function in knockout strains.

Researchers should validate that epitope tags do not interfere with protein function by conducting complementation assays in knockout strains to ensure the recombinant protein behaves similarly to the native form.

What are the implications of pan-azole resistance in M. guilliermondii for laboratory strain development?

The emergence of pan-azole resistant M. guilliermondii strains has significant implications for laboratory strain development and safety protocols. Recent studies have identified clinical isolates with combined F126L and L505F mutations in Erg11 that confer resistance to multiple azole antifungals . Additionally, some strains exhibit overexpression of the Cdr1 efflux pump, further enhancing resistance .

For laboratory strain development, researchers should:

• Implement strict biosafety measures: Given M. guilliermondii's potential pathogenicity and emerging drug resistance, laboratory strains should be handled according to appropriate biosafety guidelines.

• Screen candidate strains: New isolates should undergo antifungal susceptibility testing and genotyping for known resistance mutations before development as expression hosts.

• Consider genetic modifications: For laboratory strains, deletions in virulence factors or drug resistance genes could improve safety profiles while maintaining desirable expression characteristics.

• Develop non-azole selection markers: The increasing prevalence of azole resistance necessitates alternative selection strategies, such as the Hygromycin B system described for strain SMB .

• Monitor strain stability: Regular verification of genotype and phenotype is essential to detect any spontaneous mutations that might affect either expression efficiency or safety profile.

These considerations must be balanced against the advantages M. guilliermondii offers as an expression host, including its rapid induction kinetics and potential for high-level protein production.

What purification strategies are most effective for recombinant AIM11 from M. guilliermondii?

Purifying recombinant AIM11 from M. guilliermondii presents several challenges due to its predicted membrane association and mitochondrial localization. Based on approaches used for similar proteins, the following purification strategy is recommended:

For functional studies, it's crucial to maintain the protein in a detergent environment throughout purification. Protein stability should be monitored throughout purification using techniques such as thermal shift assays. Expected yields would typically range from 5-20 mg/L of culture, depending on expression optimization. Purification to >90% homogeneity is achievable with this protocol, based on results with other membrane proteins expressed in yeast systems.

How can researchers design functional assays to characterize AIM11 activity in vitro?

Designing functional assays for AIM11 requires understanding its predicted roles in mitochondrial inheritance and membrane function. The following assays can be implemented to characterize different aspects of AIM11 activity:

• Membrane binding assays: Using liposomes composed of mitochondrial membrane lipids and purified recombinant AIM11, researchers can assess binding affinity through:

  • Co-sedimentation assays with ultracentrifugation

  • Surface plasmon resonance to determine binding kinetics

  • Fluorescence resonance energy transfer (FRET) with labeled protein and lipids

• Protein-protein interaction studies:

  • Co-immunoprecipitation to identify binding partners

  • Yeast two-hybrid screening to map interaction domains

  • Biolayer interferometry to measure binding constants with known mitochondrial proteins

• Mitochondrial morphology assessment:

  • Complementation assays in AIM11 knockout cells with fluorescently-labeled mitochondria

  • Live-cell imaging to track mitochondrial distribution during cell division

  • Quantification of mitochondrial network parameters using image analysis software

• Functional reconstitution:

  • Proteoliposome formation with purified AIM11

  • Measurement of membrane potential using voltage-sensitive dyes

  • Assessment of membrane permeability changes with fluorescent probes

Each assay should include appropriate controls, such as heat-inactivated AIM11, AIM11 with mutations in predicted functional domains, and known inhibitors of related processes. Statistical analysis should employ ANOVA with post-hoc tests to determine significant differences between experimental conditions.

What approaches effectively address contamination risks in M. guilliermondii cultures?

M. guilliermondii presents unique contamination challenges in laboratory settings due to its status as both an expression host and potential pathogen . Implementation of the following contamination control strategy is recommended:

Additionally, researchers should implement strict aseptic technique, including using laminar flow cabinets for all manipulations and regular decontamination of work surfaces with 70% ethanol or specialized fungicidal agents. For large-scale cultures, in-line sterile filtration and regular sampling for contamination monitoring are essential.

How can multivariate statistical methods optimize AIM11 expression conditions?

Optimizing AIM11 expression requires systematic investigation of multiple variables that potentially influence protein yield and solubility. A multivariate statistical approach offers significant advantages over traditional one-factor-at-a-time methods :

• Experimental design selection:

  • For initial screening: Plackett-Burman design to identify significant factors from many variables

  • For optimization: Central Composite Design or Box-Behnken Design to model response surfaces and identify optimal conditions

• Critical variables to investigate:

  • Temperature (16-30°C)

  • Inducer concentration (0.1-1.0% methanol)

  • Induction duration (24-96 hours)

  • Media composition (carbon source, nitrogen ratio, trace elements)

  • pH (4.5-7.0)

• Response variables to measure:

  • Total protein expression (mg/L)

  • Soluble fraction percentage

  • Functional activity (specific to AIM11)

  • Cell growth (OD600)

• Statistical analysis methodology:

  • ANOVA to determine significant factors and interactions

  • Response surface methodology to visualize factor interactions

  • Regression analysis to develop predictive models

• Validation experiments:

  • Confirmation runs at predicted optimal conditions

  • Scale-up tests to verify transferability to larger volumes

This approach can be visualized in the following experimental design matrix for a Central Composite Design investigating three key variables:

By implementing this approach, researchers can identify optimal conditions that maximize both yield and solubility of recombinant AIM11, potentially achieving expression levels of 100-250 mg/L based on results with other recombinant proteins in yeast systems .

What are the most promising applications for recombinant AIM11 research?

Recombinant AIM11 research opens several promising avenues for both basic science and biotechnological applications. Understanding mitochondrial inheritance mechanisms through AIM11 characterization may reveal fundamental insights into organelle distribution during cell division. From a biotechnology perspective, M. guilliermondii represents an emerging alternative expression host that overcomes limitations of conventional systems . The optimization methods described for AIM11 expression can be transferred to other challenging recombinant proteins, particularly those involved in membrane functions or requiring post-translational modifications.