Recombinant Meyerozyma guilliermondii Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order for preferential processing.
Synonyms
RCF1; AIM31; PGUG_02673; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)
Target Names
RCF1
Target Protein Sequence
MDIIQKMVFKSKQQPLVPIGALATTGAIILASKSIRRGDRIKTQIYFRYRIGFQLLTLVA LVAGGLYYQTETAQQKQTREEKLRDKAKLREKLWIEELERRDAVIQERKKRLEESKAELL EVAQQGFEEARETETREAQLKKEEIEEKEN
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links

KEGG: pgu:PGUG_02673

STRING: 4929.A5DHC2

Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How does AIM31 contribute to mitochondrial inheritance patterns?

Mitochondrial inheritance typically follows a uniparental pattern in most eukaryotes, including yeasts. While the specific mechanism of AIM31 in M. guilliermondii is not fully characterized, research on mitochondrial inheritance proteins suggests it may be involved in processes that ensure proper segregation of mitochondria during cell division. In many species, mitochondrial inheritance involves regulated processes where specific proteins control the distribution of mitochondrial DNA (mtDNA) . For instance, in humans, proteins involved in mitochondrial inheritance can undergo post-translational modifications such as phosphorylation, which alters their localization and function . Similar mechanisms may be at work with AIM31 in M. guilliermondii, where the protein might participate in processes that determine which mitochondria are retained or eliminated during cellular division, thus contributing to the established inheritance pattern.

How is AIM31 structurally characterized in Meyerozyma guilliermondii?

The structural characterization of M. guilliermondii AIM31 involves multiple experimental approaches. The primary sequence of AIM31 (150 amino acids) provides the foundation for structural studies . Computational analysis of this sequence can predict secondary structures (α-helices, β-sheets), hydrophobic regions, and potential functional domains. For experimental structure determination, researchers typically express and purify the recombinant protein for techniques such as X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy. AIM31 contains regions that suggest it may have membrane-associated domains, based on the presence of hydrophobic amino acid stretches in its sequence . Additionally, the protein's mitochondrial localization signal would be an important structural feature to characterize, as it directs the protein to its proper subcellular location. Advanced structural studies would also examine potential phosphorylation sites and other post-translational modifications that might regulate the protein's function.

What are the optimal conditions for expressing recombinant AIM31 from Meyerozyma guilliermondii?

Expressing recombinant M. guilliermondii AIM31 requires careful optimization of expression systems and conditions. When working with recombinant AIM31, the protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . For expression, researchers have several options:

  • Heterologous Expression Systems:

    • E. coli: The most common system for initial attempts, though mitochondrial proteins may form inclusion bodies

    • Yeast Expression Systems: Using S. cerevisiae or M. guilliermondii itself may provide more appropriate post-translational modifications

    • Mammalian Cell Lines: For studies requiring authentic eukaryotic processing

  • Expression Conditions:

    • Temperature: Often lowered (16-25°C) to improve proper folding

    • Induction parameters: Optimized concentration of inducer and induction time

    • Media composition: Enhanced with additives that support mitochondrial protein expression

M. guilliermondii itself has been investigated as a potential expression host for recombinant proteins, and could potentially be used for homologous expression of AIM31 . When using M. guilliermondii as an expression host, Hygromycin B (50 μg/mL) has been found to be an effective selection marker .

How can I design experiments to study AIM31 function in mitochondrial inheritance?

Designing robust experiments to study AIM31 function requires careful consideration of experimental design principles. A true experimental approach would allow you to establish causation between AIM31 and mitochondrial inheritance patterns . This approach requires:

  • Control Group Comparison:

    • Wild-type cells with normal AIM31 expression

    • Mutant cells with AIM31 deletion or modification

    • This addresses both "If X, then Y" and "If not X, then not Y" propositions essential for establishing causality

  • Genetic Manipulation Approaches:

    • Gene knockout or knockdown (CRISPR-Cas9, RNAi)

    • Site-directed mutagenesis of potential functional domains

    • Overexpression studies

  • Experimental Readouts:

    • Mitochondrial distribution visualization using fluorescent markers

    • mtDNA quantification in daughter cells

    • Analysis of mitochondrial morphology and function

  • Temporal Analysis:

    • Time-course experiments during cell division

    • Synchronization of cell cultures to observe specific cell cycle stages

By systematically manipulating AIM31 expression or function and measuring the consequences on mitochondrial inheritance, researchers can establish causal relationships between the protein and specific cellular processes .

What methodologies are most effective for studying AIM31 phosphorylation and its impact on function?

Phosphorylation can significantly affect protein function, particularly in mitochondrial proteins involved in inheritance patterns. Research on mitochondrial proteins has shown that phosphorylation of serine residues can alter protein localization and function . To study AIM31 phosphorylation:

  • Identification of Phosphorylation Sites:

    • Mass spectrometry (LC-MS/MS) to detect phosphorylation sites, similar to the approach used to identify phosphorylation at S31 and S34 in human sperm TFAM

    • Computational prediction using phosphorylation site algorithms

  • Functional Analysis of Phosphorylation:

    • Site-directed mutagenesis to create phosphomimetic mutants (serine to aspartate) or phospho-null mutants (serine to alanine)

    • Expression of these variants and assessment of localization via confocal microscopy

    • Analysis of how these mutations affect mitochondrial inheritance patterns

  • Phosphorylation Dynamics:

    • Time-course analysis of phosphorylation status during cell cycle

    • Identification of kinases and phosphatases that regulate AIM31

This approach is supported by studies of other mitochondrial proteins, where phosphorylation of the mitochondrial targeting sequence prevented import into mitochondria, resulting in altered protein localization . For example, phosphomimicking variants (S31DD/S34DD) of human TFAM showed altered localization compared to phospho-null variants (S31AA/S34AA) .

How does AIM31 interact with other mitochondrial proteins to regulate inheritance?

Investigating protein-protein interactions of AIM31 requires a combination of biochemical, genetic, and imaging approaches. These interactions are likely crucial for understanding how AIM31 functions in mitochondrial inheritance networks:

  • Interaction Screening Methods:

    • Yeast two-hybrid assays

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID, APEX)

    • FRET/BRET for analyzing interactions in living cells

  • Functional Validation:

    • Co-localization studies using fluorescence microscopy

    • Genetic interaction studies (synthetic lethality/sickness)

    • Double knockout/knockdown experiments

  • Interaction Network Analysis:

    TechniqueAdvantagesLimitationsData Output
    Co-IP/MSIdentifies direct and indirect interactorsMay miss transient interactionsList of potential interacting proteins
    Yeast two-hybridDetects direct interactionsHigh false positive rateBinary interaction data
    Proximity labelingWorks in native cellular environmentMay label proximal but non-interacting proteinsSpatial proteomics data
    FRETDetects interactions in living cellsRequires fluorescent taggingDynamic interaction data

Building a comprehensive interaction network will provide insights into how AIM31 functions within the broader context of mitochondrial inheritance pathways and may reveal novel regulatory mechanisms.

What role might AIM31 play in mitochondrial DNA maintenance and inheritance?

Research on mitochondrial inheritance proteins suggests AIM31 may be involved in mtDNA maintenance mechanisms. Studies of mitochondrial inheritance have shown that proteins like TFAM play crucial roles in protecting, maintaining, and transcribing mtDNA . To investigate AIM31's potential role in mtDNA maintenance:

  • mtDNA Content Analysis:

    • qPCR quantification of mtDNA in wild-type vs. AIM31 mutant cells

    • Visualization of nucleoids using DNA-specific dyes or fluorescent proteins

  • mtDNA Integrity Assessment:

    • Long-range PCR to detect large-scale deletions

    • Next-generation sequencing to identify mutations or structural variations

  • Nucleoid Association Studies:

    • ChIP-seq to determine if AIM31 associates with mtDNA

    • Co-localization with known nucleoid proteins

  • Functional Consequences:

    • Measurement of mitochondrial transcription and translation

    • Assessment of respiratory chain function

    • Analysis of mitochondrial membrane potential

Understanding AIM31's role in mtDNA maintenance would provide valuable insights into how mitochondrial inheritance is regulated and potentially reveal mechanisms similar to those observed in other species, where nuclear-encoded proteins govern mitochondrial genome inheritance .

How can CRISPR-Cas9 be utilized to study AIM31 function in Meyerozyma guilliermondii?

CRISPR-Cas9 technology offers powerful approaches for precise genetic manipulation of AIM31 in M. guilliermondii:

  • Gene Knockout Strategy:

    • Design guide RNAs targeting the AIM31 coding sequence

    • Create repair templates with selection markers (e.g., Hygromycin B resistance, which has been shown effective in M. guilliermondii)

    • Screen transformants for successful gene disruption

  • Domain-Specific Mutations:

    • Create point mutations in potential functional domains

    • Generate phospho-null or phosphomimetic mutants to study regulation

    • Introduce tags for visualization or purification

  • Promoter Modification:

    • Replace native promoter with inducible promoters

    • Create expression gradients to assess dosage effects

  • Experimental Design Considerations:

    • Include appropriate controls (wild-type, off-target controls)

    • Design experiments to establish causality between genetic modifications and phenotypes

    • Use multiple guide RNAs to minimize off-target effects

Implementation of CRISPR-Cas9 in M. guilliermondii would need to be optimized, as transformation efficiencies and homologous recombination rates may differ from model organisms like S. cerevisiae. The successful use of Hygromycin B as a selection marker in M. guilliermondii provides a useful tool for selecting transformants .

How does AIM31 function compare with similar proteins in other yeast species?

Comparative analysis of AIM31 across yeast species provides evolutionary insights and functional predictions:

  • Homology Analysis:

    • Sequence alignment of AIM31 homologs across fungal species

    • Identification of conserved domains and motifs

    • Phylogenetic analysis to trace evolutionary relationships

  • Functional Conservation Assessment:

    • Complementation studies (expressing M. guilliermondii AIM31 in other yeast species)

    • Comparison of phenotypes in knockout/knockdown models

    • Analysis of protein-protein interaction networks across species

  • Structural Comparison:

    • Comparative modeling based on known structures

    • Analysis of conserved vs. variable regions

    • Prediction of functional sites based on evolutionary conservation

Understanding the similarities and differences between AIM31 in M. guilliermondii and related proteins in other yeasts will help predict its function and reveal species-specific adaptations in mitochondrial inheritance mechanisms.

What insights can AIM31 research provide for understanding mitochondrial inheritance in higher eukaryotes?

Research on yeast mitochondrial proteins has historically provided valuable insights applicable to higher eukaryotes:

  • Conservation of Mechanisms:

    • Uniparental inheritance of mtDNA is an evolutionary trait found in nearly all eukaryotes

    • Some mechanisms of paternal mtDNA elimination appear conserved

    • Phosphorylation as a regulatory mechanism for mitochondrial proteins appears conserved across species

  • Translational Relevance:

    • Understanding basic mechanisms in yeast can inform research on human mitochondrial diseases

    • Yeast models provide simplified systems to study complex inheritance patterns

    • Conservation of phosphorylation sites in mitochondrial targeting sequences across species suggests shared regulatory mechanisms

  • Methodological Approaches:

    • Experimental designs established in yeast studies can be adapted to mammalian systems

    • Focus group approaches similar to those used in healthcare research may be beneficial for collecting information from various experts in the field

Research on M. guilliermondii AIM31 may reveal fundamental principles of mitochondrial inheritance that could have implications for understanding similar processes in human cells, potentially contributing to our knowledge of mitochondrial diseases and inheritance patterns.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.