Recombinant Meyerozyma guilliermondii Golgi to ER traffic protein 1 (GET1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GET1; PGUG_02080; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)
Target Names
GET1
Target Protein Sequence
MEPYTLLLFIFVIQIVKQIISAVGKQSIESISWVLYCRVAPKFGHSKLASMSQKSSQLRT
VAGERRAVSAQDQYAKWTKLNRQHDKLVAEIEQLQKEVDLDKVKVNTFTGYLIAILTSIP
IWFFRVWYRSVVLFYFPPGILPRALEWSIALPFTVTGGVSLTVWMMAAGAVASSLTFLFM
FPFEKAVPKPVLAKKSPQQL
Uniprot No.
Target Background
Function
Recombinant *Meyerozyma guilliermondii* Golgi to ER traffic protein 1 (GET1) is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. In conjunction with GET2, it functions as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to mediate the ATP-dependent retrieval of resident ER proteins, containing a C-terminal H-D-E-L retention signal, from the Golgi apparatus back to the ER.
Database Links
KEGG: pgu:PGUG_02080
STRING: 4929.A5DFM9
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
