Recombinant Meyerozyma guilliermondii Golgi to ER traffic protein 2 (GET2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To request a specific tag type, please inform us, and we will prioritize its development.
Synonyms
GET2; PGUG_01697; Golgi to ER traffic protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-280
Protein Length
full length protein
Species
Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)
Target Names
GET2
Target Protein Sequence
MPSDREKQRILRERRQAKMAKGGASDRLNKILSQGSSVKTSAVSVLDQPQPADHDPEGMD ISTIASKPTPEPELDIDAMLNSVLGGNMGAGGAANGDPGSDPFTQMMMNMMQGGGPEGML GQEGGTNPMSANMEYQQQLIAYNLYQQRKVRHRFLVVRMVSILANFVYHFLTISDFSFSP SANPFIRSIPPTSSVSSFFQIFVAIEAVLVAAYIAASRNVPSNNNGLLVKGISMAAMFVP KLQRFQPLIMKIIGCWDTVTFVLNDLGLVVLLFGLISFRR
Uniprot No.

Target Background

Function

Recombinant Meyerozyma guilliermondii Golgi to ER traffic protein 2 (GET2) is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). It functions as a membrane receptor, in conjunction with GET1, for soluble GET3. GET3 specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER resident proteins (possessing a C-terminal H-D-E-L retention signal) from the Golgi apparatus back to the ER.

Database Links

KEGG: pgu:PGUG_01697

STRING: 4929.A5DEJ6

Protein Families
GET2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Meyerozyma guilliermondii and why would it be valuable for GET2 protein studies?

M. guilliermondii is a yeast species that has gained research attention for both its pathogenic potential and biotechnological applications. It contributes to invasive candidiasis and has been identified as a promising protein expression host, with strain SO showing 99% proteome similarity to the clinically isolated ATCC 6260 . The species demonstrates remarkable stress tolerance, particularly to salt conditions, making it potentially valuable for studying membrane proteins like GET2 under various environmental stressors . Different clades of M. guilliermondii have been identified (clade 1, 2, and 3) with varying prevalence and characteristics, suggesting genetic diversity that could affect protein expression systems .

  • What molecular techniques are recommended for identifying Meyerozyma guilliermondii strains in GET2 studies?

Molecular identification of M. guilliermondii typically involves sequencing the Internal Transcribed Spacer (ITS) region of ribosomal DNA using the V9G (5′-TTACGTCCCTGCCCTTTGTA-3′) and LS266 (5′-GCATTCCCAAACAACTCGACTC-3′) primer pairs . For research involving GET2, this identification is crucial as:

  • Sequences should be assembled from multiple reads per isolate (typically 2-4 reads)

  • Editing should achieve a Phred quality score >30

  • Sequence alignment using the muscle algorithm with manual correction via MEGA X software

  • Phylogenetic analysis using the Neighbor-Joining method based on the Kimura two-parameter model with 1,000 bootstrap pseudo-replicates

This approach has revealed significant diversity within the M. guilliermondii species complex that could affect protein expression characteristics.

  • How can I establish a recombinant protein expression system in M. guilliermondii for GET2 studies?

Based on successful recombinant protein expression in M. guilliermondii strain GXDK6, we recommend a plasmid-based system using the following methodology:

  • PCR amplification of the GET2 gene using genome as template

  • Linearization of an appropriate vector (e.g., pPICZA) by reverse amplification PCR

  • Ligation of linearized plasmid with GET2 using seamless cloning

  • Transformation into E. coli DH5α for amplification

  • Selection of positive transformants using antibiotic resistance (e.g., zeocin)

  • Verification via colony PCR and plasmid extraction

  • Transformation into M. guilliermondii

This system has demonstrated effectiveness for other proteins, showing significant increases in enzyme activity (24.89%) and enhanced production of target compounds (56.36%) in recombinant M. guilliermondii strains .

  • What is the role of the ER-Golgi trafficking pathway in yeast models and how might GET2 function?

In yeast models, the ER-Golgi trafficking pathway involves the ER-Golgi intermediate compartment (ERGIC), which mediates cargo traffic through cisternal maturation. Research using super-resolution live imaging microscopy (SCLIM) has identified the ERGIC in budding yeast and demonstrated its approach and contact behavior toward ER exit sites before maturing into the Golgi .

GET2, as part of the GET complex, would likely function in this system by:

  • Facilitating the insertion of tail-anchored proteins into the ER membrane

  • Interacting with other GET complex components to form a transmembrane channel

  • Potentially playing a role in retrieving specific proteins from the ERGIC, similar to how Rer1 and Erd2 function as retrieval receptors for ER-resident proteins

  • How do environmental stressors affect protein expression in M. guilliermondii and what implications might this have for GET2?

Environmental stressors, particularly salt stress, significantly affect protein expression in M. guilliermondii. Research on strain GXDK6 has shown that 10% NaCl stress alters the expression of key metabolic genes compared to non-NaCl conditions . Specifically:

ConditionEffect on Gene ExpressionMetabolic Impact
10% NaClUpregulation of AAT2Enhanced dopamine anabolism
10% NaClDownregulation of AO-IReduced dopamine catabolism
Non-NaClBaseline expressionStandard metabolic activity

This differential gene expression contributed to a 2.51-fold higher production of dopamine under salt stress . For GET2 studies, these findings suggest that salt stress could be leveraged to modulate expression of membrane proteins, potentially enhancing production of functional GET2 for structural or functional studies.

Advanced Research Questions

  • What multi-omics approaches would be most effective for studying GET2 function in M. guilliermondii?

An integrated multi-omics approach for studying GET2 in M. guilliermondii should include:

Genomic analysis: Whole-genome sequencing to identify GET2 and related genes in the GET complex. The CTAB method for DNA extraction followed by PCR verification and agarose gel electrophoresis has proven effective in M. guilliermondii research .

Transcriptomic analysis: RNA sequencing to quantify GET2 expression levels under different conditions, using cut-off values (|Fold change| > 2.0 and FDR ≤0.001) to identify differential expression patterns .

Proteomic analysis: Protein identification and quantification to examine GET2 production and interactions, with cut-off values (p-value <0.05 and |FC| > 1.20) to identify significant changes .

Integration: Correlation analysis between differentially expressed proteins and the transcriptome database to understand post-transcriptional regulation of GET2 and its partners .

Validation: RT-qPCR and targeted protein analysis techniques to confirm expression patterns and functional hypotheses derived from omics data .

  • How might the genetic diversity within M. guilliermondii clades impact GET2 expression and function?

The diversity within M. guilliermondii has significant implications for GET2 research:

CladePrevalenceCharacteristicsPotential Impact on GET2 Research
Clade 194 isolatesLower triazole MICsPossibly more amenable to standard transformation protocols
Clade 219 isolatesHigher triazole MICs, increasing prevalenceMay require modified expression systems due to different membrane properties
Clade 33 isolatesRare, limited characterizationPotential for novel GET2 variants with unique properties

The significant increase in clade 2 prevalence over time (from period 1 to period 2 in clinical isolates) suggests evolutionary advantages that might relate to membrane properties or protein trafficking. When designing GET2 expression systems, researchers should consider:

  • Clade-specific optimization of expression vectors

  • Potential variations in GET2 sequence and function between clades

  • Different drug susceptibilities that might affect selection marker choices

  • What experimental designs would best capture the dynamics of GET2 function in the ER-Golgi trafficking pathway?

To effectively study GET2 dynamics in the ER-Golgi trafficking pathway, we recommend:

Dual-color 4D imaging: Simultaneously track fluorescently-tagged GET2 along with markers for specific compartments (ER, ERGIC, Golgi) to visualize protein movement and interactions over time .

Pharmacological interventions: Use Golgi-disrupting agents like brefeldin A (BFA) to perturb the system and observe GET2 behavior under membrane stress conditions .

Multiple marker tracking: Employ various markers such as Rer1 and Erd2 (Golgi-resident retrieval receptors) alongside GET2 to understand temporal relationships in trafficking events .

CRISPR-based modifications: Create GET2 variants to probe structure-function relationships, potentially using the same molecular biology techniques that have been successful for other genes in M. guilliermondii .

Quantitative analysis of peak fluorescence signals to determine the temporal ordering of GET2 activity in relation to other trafficking events, similar to observations that ER-resident proteins are retrieved from the ERGIC before reaching the Golgi .

  • How do the membrane characteristics of M. guilliermondii affect expression and function of membrane proteins like GET2?

M. guilliermondii shows varied sensitivity to membrane and cell wall stressors, which has significant implications for membrane protein research:

The species demonstrates lower sensitivity to β-mercaptoethanol and higher sensitivity to lithium compared to avirulent S. cerevisiae, while exhibiting similar tolerance to cell wall-perturbing Congo Red as C. albicans .

For GET2 research, these membrane characteristics suggest:

  • Potential for higher stability of membrane proteins under certain stress conditions

  • Necessity for strain-specific optimization of membrane protein expression

  • Opportunity to leverage M. guilliermondii's unique membrane properties for structural studies of membrane proteins

Additionally, M. guilliermondii strain SO demonstrates enhanced biofilm formation (7.5× higher biofilm mass compared to S. cerevisiae) , which may provide microenvironments that influence membrane protein folding and function. These unique membrane properties could be advantageous for studying GET2 under conditions that might destabilize membrane proteins in other expression systems.

  • What analytical techniques would best resolve contradictory data regarding GET2 function in different M. guilliermondii strains?

When faced with contradictory data about GET2 function across different M. guilliermondii strains, we recommend:

Phylogenetic analysis: Determine if functional differences correlate with genetic relationships between strains, using the Neighbor-Joining method with Kimura two-parameter model as successfully applied for M. guilliermondii classification .

Statistical validation: Apply rigorous statistical methods like those used in M. guilliermondii antifungal susceptibility studies, including χ2 tests for prevalence comparisons and Kruskal–Wallis tests for quantitative differences .

Standardized phenotypic assays: Develop consistent assays measuring GET2-dependent phenotypes across strains, similar to the standardized approaches used for measuring biofilm formation or stress tolerance in M. guilliermondii .

Cross-complementation experiments: Express GET2 from one strain in another to determine if functional differences are intrinsic to the protein or due to strain background.

Structural biology approaches: When contradictory functional data persists, resolve through direct structural analysis of GET2 variants, potentially using the same expression and purification systems that have been successful for other M. guilliermondii proteins .

The successful application of these approaches would not only resolve contradictions but potentially reveal strain-specific adaptations in the GET complex that could inform broader understanding of membrane protein targeting mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.