Recombinant Meyerozyma guilliermondii Mitochondrial thiamine pyrophosphate carrier 1 (TPC1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TPC1; PGUG_03180; Mitochondrial thiamine pyrophosphate carrier 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)
Target Names
TPC1
Target Protein Sequence
MATPREDHLKKGATASVYHTLVAGSVSGAVARAVTAPLDTVKIRLQLSNKSLGAHDGLRQ TVVRIFKNEGIRAFWKGNVPAEIMYILYGATQFTSYSMFSKALTELETTYGFNLRPSNHS LIVGTSAGLTSLIVTYPFDLLRTRLAANSERHFLSMTAVIKQVRASGGLAGLYMGAKPTL LSLGLNSGLMFWTYEIAREVSAQYKDNIPFIEGFCGFFAGASSKGITFPLDTLRKRMQMR SSKTSIIGLARTILRREGLFGFYKGFGISLIKTAPTSAVSLFVYEVVLNGM
Uniprot No.

Target Background

Function
Mitochondrial transporter mediating the uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Meyerozyma guilliermondii and why is it significant in TPC1 research?

Meyerozyma guilliermondii (formerly known as Candida guilliermondii) is a non-albicans Candida species that has emerged in recent decades as an agent of serious diseases, including bloodstream infections. It belongs to the Meyerozyma guilliermondii species complex, which also includes Meyerozyma caribbica . The significance of M. guilliermondii in TPC1 research stems from its unique mitochondrial properties and potential as a model organism for understanding thiamine pyrophosphate transport mechanisms. M. guilliermondii has gained attention due to its reduced susceptibility to certain antifungal agents and variable production of virulence-related enzymes . As a eukaryotic organism with accessible genetic manipulation tools, it provides a valuable system for studying mitochondrial transporters like TPC1.

How does the mitochondrial thiamine pyrophosphate carrier function in cellular metabolism?

Mitochondrial thiamine pyrophosphate carrier 1 (TPC1) plays a crucial role in cellular metabolism by transporting thiamine pyrophosphate (TPP) from the cytoplasm into the mitochondria. Mammalian cells obtain vitamin B1 (thiamin) from their environment and convert it to TPP in the cytoplasm . Most of this TPP is then transported into the mitochondria via a carrier-mediated process involving the mitochondrial thiamine pyrophosphate transporter (MTPPT) .

The transport process is pH-independent, saturable (with a Km value of approximately 6.79±0.53 μM in mouse liver mitochondria), and specific for TPP . Once inside the mitochondria, TPP serves as an essential cofactor for several key mitochondrial enzymes involved in energy metabolism, including pyruvate dehydrogenase and α-ketoglutarate dehydrogenase. Disruption of this transport mechanism can lead to cellular energy deficits and has been linked to serious conditions including Amish lethal microcephaly and neuropathy and bilateral striatal necrosis .

What are the structural characteristics of TPC1 proteins?

TPC1 proteins are structurally complex transporters with distinct domains that work cooperatively to facilitate TPP transport. Based on structural studies, TPC1 contains multiple transmembrane domains organized into distinct modules that contribute to various functions:

  • Voltage-sensing domains (VSDs): TPC1 contains two voltage-sensing domains, with VSD2 being responsible for voltage sensing while VSD1 does not contribute to voltage regulation .

  • Ion conduction pathway: The central pore dilates upon activation to conduct ions.

  • Regulatory binding sites: These include sites for Ca²⁺ binding that modulate channel activity.

The voltage-sensing domain (VSD2) contains four arginine residues separated by helical turns within one transmembrane span . At resting potential, VSD2 is attracted electrostatically to the cytoplasmic side of the membrane, keeping the channel closed. During depolarization, VSD2 moves outward toward the lumen side, leading to conformational changes that dilate the central pore and allow ion conduction .

In human MTPPT, all three modules of the protein cooperate (though at different efficiency levels) in mitochondrial targeting rather than acting as independent targeting modules .

What are the optimal experimental designs for studying recombinant M. guilliermondii TPC1?

When designing experiments to study recombinant M. guilliermondii TPC1, researchers should consider several key approaches to ensure valid and reliable results:

True Experimental Design with Control Groups:
Implement a true experimental design with both control and experimental groups to establish cause-effect relationships . For TPC1 studies, this would involve:

  • Control group: Expression system without the TPC1 gene or with a non-functional mutant

  • Experimental group: Expression system with functional recombinant TPC1

  • Random assignment of samples to minimize bias

Variable Manipulation:
Carefully manipulate independent variables to observe effects on dependent variables . Key variables to consider include:

Independent VariablesDependent VariablesControl Variables
Expression conditionsTPC1 expression levelGrowth medium composition
Mutations in TPC1Transport activityTemperature
Membrane potentialIon conductancepH
Ca²⁺ concentrationChannel openingCell density

Experimental Steps:

  • Define clear research questions and hypotheses about TPC1 function

  • Identify and control extraneous variables that might affect results

  • Design systematic manipulations of independent variables

  • Implement appropriate controls and replication

  • Select suitable measurement techniques for dependent variables

This approach helps establish causal relationships between experimental manipulations and TPC1 function while controlling for confounding factors.

What methods are most effective for the recombinant expression of M. guilliermondii TPC1?

The recombinant expression of M. guilliermondii TPC1 requires careful consideration of expression systems, purification strategies, and functional validation. Based on research with similar transporters, the following methodological approaches are recommended:

Expression Systems:

  • Yeast expression systems: Saccharomyces cerevisiae or Pichia pastoris are preferred for expressing fungal membrane proteins as they provide a eukaryotic environment with appropriate post-translational modifications and membrane insertion machinery.

  • Bacterial systems: For structural studies requiring high protein yields, E. coli systems with specialized strains (C41, C43, or Rosetta) can be used, though refolding may be necessary.

Expression Strategy:

  • Use inducible promoters (GAL1 for yeast, T7 for bacteria) to control expression timing

  • Incorporate affinity tags (His6, FLAG, or Strep-II) for detection and purification

  • Consider fusion partners (MBP, SUMO) to enhance solubility

  • Include protease cleavage sites for tag removal

Purification Protocol:

  • Membrane fraction isolation using differential centrifugation

  • Solubilization with mild detergents (DDM, LMNG, or digitonin)

  • Affinity chromatography using tagged constructs

  • Size exclusion chromatography for final purification

Validation Methods:

  • Western blotting to confirm expression

  • Fluorescence microscopy with GFP-tagged constructs to verify mitochondrial localization

  • Functional reconstitution in liposomes to assess transport activity

Similar approaches have been successfully used for the study of human MTPPT, where GFP-tagged constructs helped visualize mitochondrial targeting .

How can researchers accurately measure TPC1 transport activity in recombinant systems?

Accurate measurement of TPC1 transport activity in recombinant systems requires specialized techniques that can detect the movement of thiamine pyrophosphate across membranes. Several complementary approaches are recommended:

Radioisotope Transport Assays:
Using custom-synthesized ³H-TPP as a substrate allows for direct quantification of transport activity . This approach involves:

  • Isolation of mitochondria or preparation of proteoliposomes containing recombinant TPC1

  • Incubation with radiolabeled ³H-TPP under various conditions

  • Rapid filtration to separate transported TPP from free TPP

  • Scintillation counting to quantify uptake

Kinetic Characterization:
Determine key transport parameters by measuring uptake across a range of substrate concentrations. Based on studies with mouse liver mitochondria, parameters typically include:

  • Km value (approximately 6.79±0.53 μM for mouse MTPPT)

  • Vmax (maximum transport rate)

  • Specificity for TPP versus other thiamine derivatives

Electrophysiological Methods:
For detailed mechanistic studies, patch-clamp techniques or planar lipid bilayer recordings can measure TPC1 channel activity directly. This approach can reveal:

  • Voltage dependence of transport

  • Effects of Ca²⁺ on channel gating

  • Single-channel conductance properties

Fluorescence-Based Assays:
Alternative methods using fluorescent TPP analogs or membrane potential-sensitive dyes can provide real-time monitoring of transport activity in intact cells.

The choice of method depends on the specific research question, with radioisotope assays providing the most direct measure of TPP transport, as demonstrated in studies of human and mouse MTPPT .

How do mutations in TPC1 affect its function and what are the implications for experimental design?

Mutations in TPC1 can significantly alter its function through various mechanisms, requiring careful experimental design to accurately characterize these effects:

Types of Mutations and Their Effects:
Clinical mutations in human MTPPT (G125S and G177A) have been shown to:

  • Maintain proper mitochondrial targeting

  • Significantly inhibit ³H-TPP uptake

  • Decrease the expression level of the MTPPT protein

In voltage-dependent TPC1 channels, mutations in the inhibitory luminal Ca²⁺ binding site have been utilized to study channel activation mechanisms .

Experimental Design Considerations:

Mutation TypeExperimental ApproachMeasurements
Clinical mutations (e.g., G125S, G177A)Site-directed mutagenesisProtein expression, localization, transport activity
Regulatory site mutationsCa²⁺ binding site modificationsVoltage dependence, ion conductance
Voltage sensor mutationsCharge-altering substitutions in VSD2Gating properties, movement of voltage sensor
Truncation mutantsSerial truncation analysisMitochondrial targeting efficiency

Methodological Approaches:

  • Structure-Function Analysis: Generate a series of point mutations to identify critical residues for TPP binding, transport, and voltage sensing.

  • Truncation Analysis: Create truncated versions of the protein to determine which regions are essential for targeting and function, as demonstrated with human MTPPT where all three modules cooperated in mitochondrial targeting .

  • Chimeric Proteins: Construct chimeras between TPC1 and related transporters to identify domain-specific functions.

  • Complementation Studies: Test the ability of mutants to rescue phenotypes in TPC1-deficient systems.

When interpreting results from mutation studies, researchers should consider both direct effects on transport activity and indirect effects on protein expression, stability, and targeting.

What are the key challenges in differentiating between TPC1 from M. guilliermondii and homologous transporters from other species?

Differentiating between TPC1 from M. guilliermondii and homologous transporters from other species presents several challenges that researchers must address through careful experimental design and analytical approaches:

Sequence Similarity Challenges:
Thiamine pyrophosphate transporters often share significant sequence homology across species, making discrimination difficult. For instance, within the Meyerozyma genus, M. guilliermondii and M. caribbica are closely related species that can be difficult to distinguish without molecular techniques .

Recommended Differentiation Methods:

  • Molecular Identification:

    • ITS1-5.8S-ITS2 region sequencing has been successfully used to differentiate Meyerozyma species

    • Multiple sequence alignment with phylogenetic analysis to identify species-specific signatures

  • Functional Characterization:

    • Comparative kinetic analysis of transport parameters

    • Substrate specificity testing across different thiamine derivatives

    • Response to inhibitors and regulatory factors

  • Immunological Detection:

    • Development of species-specific antibodies targeting unique epitopes

    • Western blot analysis with careful antibody validation

  • Genetic Approaches:

    • Species-specific PCR primers targeting unique sequences

    • CRISPR-based targeting of species-specific genomic regions

Validation Strategy:
When working with recombinant TPC1, researchers should implement a multi-layered validation approach:

  • Sequence verification after cloning

  • Expression confirmation with species-specific antibodies

  • Functional validation comparing transport kinetics with published parameters

  • Mass spectrometry analysis to confirm protein identity

This comprehensive approach helps ensure accurate identification and characterization of M. guilliermondii TPC1 distinct from homologous transporters.

How does the dual role of TPC1 as both a transporter and voltage-dependent channel impact experimental approaches?

The dual functionality of TPC1 as both a transporter and voltage-dependent channel creates unique experimental challenges that require integrated methodological approaches:

Functional Duality:
TPC1 exhibits characteristics of both:

  • A carrier protein that transports thiamine pyrophosphate across membranes

  • A voltage-dependent ion channel that responds to membrane potential changes

This dual nature requires researchers to design experiments that can distinguish between and characterize both functions.

Integrative Experimental Approaches:

  • Membrane Potential Manipulation:

    • Systematically vary membrane potential using ionophores or voltage-clamp techniques

    • Measure both TPP transport and ion conductance under different voltage conditions

    • Determine the voltage-dependence of transport activity

  • Structure-Function Studies:

    • Target voltage-sensing domains, particularly VSD2 which contains four arginine residues that respond to membrane potential changes

    • Compare the effects of mutations on transport versus channel functions

    • Identify regions involved in both or exclusively in one function

  • Calcium Regulation Analysis:

    • Investigate the effects of Ca²⁺ concentration on both transport and channel activities

    • Study mutations in Ca²⁺ binding sites that affect channel activation

    • Determine if Ca²⁺ regulation differs between transport and channel modes

  • Reconstitution Systems:

    • Develop proteoliposome systems with controlled membrane potential

    • Establish patch-clamp protocols specific for TPC1

    • Implement fluorescence-based assays that can monitor both functions simultaneously

Data Analysis Considerations:
When interpreting experimental results, researchers should consider how voltage-dependence and Ca²⁺ regulation might differentially affect transport versus channel function. This requires careful experimental design that can separate these activities or measure them simultaneously under controlled conditions.

What statistical approaches are most appropriate for analyzing TPC1 transport kinetics data?

Analyzing TPC1 transport kinetics requires rigorous statistical approaches tailored to the specific experimental design and data characteristics:

Recommended Statistical Methods:

  • Enzyme Kinetics Analysis:

    • Use non-linear regression to fit transport data to Michaelis-Menten equations

    • Determine Km (approximately 6.79±0.53 μM for mouse MTPPT) and Vmax values

    • Apply Lineweaver-Burk or Eadie-Hofstee transformations for visual assessment of kinetic parameters

  • Comparative Analysis:

    • Two-way ANOVA to assess effects of multiple factors (e.g., mutations and conditions)

    • Post-hoc tests (Tukey's HSD, Bonferroni correction) for multiple comparisons

    • Paired t-tests for before/after treatment comparisons within the same preparation

  • Time-Course Data Analysis:

    • Exponential fitting for uptake curves

    • Area under the curve (AUC) calculations for cumulative transport

    • Repeated measures ANOVA for time-dependent effects

Data Validation Approaches:

  • Implement outlier detection methods (Grubbs' test, Dixon's Q test)

  • Verify normality assumptions using Shapiro-Wilk or Kolmogorov-Smirnov tests

  • Apply appropriate transformations when data violates statistical assumptions

Reporting Standards:
When reporting kinetic parameters, include:

  • Standard errors or confidence intervals (e.g., Km = 6.79±0.53 μM)

  • Sample sizes and replication details

  • Statistical test results with exact p-values

  • Visual representation through appropriate graphs (concentration-response curves, Lineweaver-Burk plots)

This comprehensive statistical approach ensures robust interpretation of TPC1 transport kinetics and facilitates meaningful comparisons between experimental conditions or between wild-type and mutant transporters.

How can researchers address data inconsistencies when comparing TPC1 function across different experimental systems?

Addressing data inconsistencies when comparing TPC1 function across different experimental systems requires systematic approaches to identify sources of variation and establish standardized methods:

Sources of Experimental Inconsistencies:

  • System-Specific Differences:

    • Membrane composition variations between expression systems

    • Post-translational modification differences

    • Presence of different accessory proteins

  • Methodological Variations:

    • Differences in isolation and purification protocols

    • Variation in transport assay conditions

    • Instrumentation sensitivity differences

Strategies for Addressing Inconsistencies:

  • Standardization Approaches:

    • Develop reference standards that can be tested across all systems

    • Establish common protocols with detailed methodology reporting

    • Use identical buffer compositions and assay conditions when possible

  • Cross-Validation Methods:

    • Test the same TPC1 construct in multiple expression systems

    • Apply multiple measurement techniques to the same samples

    • Conduct inter-laboratory validation studies

  • Statistical Approaches:

    • Meta-analysis techniques to pool data across studies

    • Normalization procedures to account for system-specific variations

    • Mixed-effects models to separate system effects from treatment effects

Recommended Reconciliation Framework:

Inconsistency TypeInvestigation ApproachResolution Strategy
Kinetic parameter differencesSystematic variation of assay conditionsIdentify condition-dependent effects
Expression level variationsQuantitative Western blottingNormalize activity to expression level
System-specific activity differencesReconstitution in defined liposomesControl membrane environment
Temperature-dependent variationsQ10 determinationNormalize to standard temperature

When reporting results that differ from previous studies, researchers should explicitly discuss potential sources of discrepancies and provide alternative interpretations based on methodological differences.

What are the best approaches for integrating structural and functional data about TPC1?

Integrating structural and functional data about TPC1 requires multidisciplinary approaches that connect molecular structure to transport mechanism and regulation:

Integration Methodologies:

  • Structure-Guided Mutagenesis:

    • Target specific residues identified in structural studies

    • Create systematic mutations in functional domains

    • Correlate structural features with transport parameters

  • Computational Approaches:

    • Molecular dynamics simulations to model conformational changes

    • Docking studies to predict substrate binding sites

    • Electrostatic analysis to understand voltage sensing

  • Spectroscopic Methods:

    • FRET-based distance measurements between domains

    • EPR spectroscopy to track conformational changes

    • Fluorescence spectroscopy to monitor substrate binding

  • Cryo-EM and Crystallographic Studies:

    • Capture different conformational states (open/closed)

    • Identify structural changes upon voltage sensing

    • Visualize Ca²⁺ binding sites and their effects on structure

Data Integration Framework:
A comprehensive framework should connect:

  • Structural features of voltage-sensing domains to voltage-dependent activation

  • Ca²⁺ binding sites to regulatory mechanisms

  • Conformational changes to transport kinetics

Visualization and Analysis Tools:

  • PyMOL or UCSF Chimera for structure visualization and analysis

  • Integrated databases combining structural and functional annotations

  • Custom data visualization approaches connecting structure to function

As demonstrated in recent studies of voltage- and Ca²⁺-dependent SV/TPC1 ion channels, detailed structural analysis has greatly enhanced understanding of the voltage-dependent ion channel activation mechanism . Similar integrated approaches for M. guilliermondii TPC1 would provide valuable insights into the relationship between structure and transport function.

How can recombinant M. guilliermondii TPC1 be used to study mitochondrial diseases related to thiamine metabolism?

Recombinant M. guilliermondii TPC1 offers a valuable model system for studying mitochondrial diseases related to thiamine metabolism, with several strategic research applications:

Disease Modeling Applications:

  • Clinical Mutation Analysis:

    • Generate recombinant TPC1 with mutations corresponding to those found in human diseases

    • Evaluate the functional consequences of clinical mutations (e.g., G125S and G177A) on thiamine pyrophosphate transport

    • Determine whether mutations affect protein targeting, expression, or intrinsic transport activity

  • Metabolic Impact Assessment:

    • Develop cellular models expressing mutant TPC1 forms

    • Measure the effect on mitochondrial function using respirometry

    • Assess the impact on thiamine-dependent enzyme activities

  • Therapeutic Screening Platform:

    • Establish high-throughput assays for TPC1 transport activity

    • Screen compound libraries for molecules that rescue mutant TPC1 function

    • Identify allosteric modulators that could enhance residual transport activity

Methodological Approach:
Research into clinical mutations in human MTPPT has shown that mutations like G125S and G177A maintain proper mitochondrial targeting but significantly inhibit TPP uptake and decrease protein expression levels . Similar approaches could be applied to study M. guilliermondii TPC1, potentially revealing shared mechanisms of dysfunction or species-specific differences.

Potential Disease Applications:
This research has direct relevance to understanding conditions such as:

  • Amish lethal microcephaly

  • Neuropathy and bilateral striatal necrosis

  • Thiamine-responsive disorders

  • Mitochondrial energy metabolism defects

By establishing the molecular basis of TPC1 dysfunction in these conditions, researchers can develop more targeted therapeutic approaches aimed at restoring mitochondrial thiamine pyrophosphate levels.

What are the most promising directions for developing selective modulators of TPC1 activity?

Developing selective modulators of TPC1 activity represents an important research direction with both basic science and potential therapeutic applications:

Target Sites for Modulation:

  • Substrate Binding Pocket:

    • Design compounds that mimic thiamine pyrophosphate structure

    • Develop partial agonists that maintain essential transport while preventing excessive activity

    • Create competitive inhibitors for experimental use

  • Voltage-Sensing Domain:

    • Target the VSD2 region containing the four arginine residues critical for voltage sensing

    • Develop compounds that stabilize either the active or inactive conformation

    • Create modulators that alter the voltage-dependence of activation

  • Calcium Regulatory Sites:

    • Design compounds that mimic or block the effects of Ca²⁺ on TPC1 activity

    • Develop allosteric modulators that enhance or inhibit Ca²⁺ sensitivity

    • Create tools to selectively control Ca²⁺-dependent regulation

Screening Strategies:

ApproachMethodologyAdvantages
Structure-based designComputational docking to identified binding sitesRational design based on structure
High-throughput functional screeningFluorescence-based transport assaysIdentifies functionally active compounds
Fragment-based screeningNMR or X-ray crystallography with small molecule fragmentsIdentifies novel binding sites
Electrophysiological profilingPatch-clamp analysis of channel propertiesDirect measurement of modulator effects

Validation Framework:
Candidate modulators should be evaluated through:

  • Binding assays to confirm target engagement

  • Functional assays to determine effects on transport activity

  • Selectivity screening against related transporters

  • Cellular assays to verify effects in biological systems

Research on voltage-dependent TPC1 channel activation mechanisms, particularly the role of mutations in the inhibitory luminal Ca²⁺ binding site , provides valuable insights that could guide the development of selective modulators targeting specific regulatory mechanisms.

How can systems biology approaches integrate TPC1 function into broader mitochondrial and cellular metabolic networks?

Systems biology approaches offer powerful frameworks for understanding how TPC1 function integrates into broader mitochondrial and cellular metabolic networks:

Multi-Omics Integration Strategies:

  • Transcriptomics Integration:

    • Analyze co-expression patterns between TPC1 and other metabolic genes

    • Identify transcriptional regulators that coordinate TPC1 expression with metabolic demands

    • Map expression changes across different physiological and stress conditions

  • Proteomics Approaches:

    • Identify TPC1 interaction partners through proximity labeling or co-immunoprecipitation

    • Map post-translational modifications that regulate TPC1 activity

    • Quantify protein level changes in response to metabolic perturbations

  • Metabolomics Integration:

    • Measure the impact of TPC1 modulation on mitochondrial and cellular metabolite profiles

    • Track thiamine-dependent metabolic pathways

    • Identify metabolic signatures of TPC1 dysfunction

  • Flux Analysis:

    • Apply ¹³C metabolic flux analysis to quantify pathway activities dependent on thiamine cofactors

    • Determine how TPC1 activity influences metabolic flux distributions

    • Model the impact of altered TPP availability on energetic pathways

Computational Modeling Approaches:

  • Kinetic Modeling:

    • Develop mathematical models incorporating TPC1 transport kinetics

    • Simulate the effects of varying TPP transport on mitochondrial metabolism

    • Predict metabolic responses to TPC1 modulation

  • Genome-Scale Metabolic Models:

    • Integrate TPC1 function into genome-scale metabolic reconstructions

    • Perform flux balance analysis under varying conditions

    • Identify synthetic lethal interactions with other metabolic genes

  • Network Analysis:

    • Map the position of TPC1 in metabolic and signaling networks

    • Identify potential regulatory hubs connected to TPC1 function

    • Analyze network robustness and vulnerability to TPC1 dysfunction

This systems-level understanding would provide context for interpreting the consequences of TPC1 mutations or dysfunction, potentially revealing unexpected connections to other cellular processes and identifying new therapeutic targets for mitochondrial disorders.

What are the critical knowledge gaps in our understanding of recombinant M. guilliermondii TPC1?

Despite significant advances in understanding TPC1 structure and function, several critical knowledge gaps remain that limit our comprehensive understanding of recombinant M. guilliermondii TPC1:

Addressing these knowledge gaps will require integrated approaches combining structural biology, biochemistry, genetics, and systems biology to develop a comprehensive understanding of M. guilliermondii TPC1 function in both basic research and potential applications.

How should researchers prioritize future studies on recombinant M. guilliermondii TPC1?

To advance our understanding of recombinant M. guilliermondii TPC1, researchers should prioritize future studies according to both scientific importance and technical feasibility:

Highest Priority Research Directions:

  • Structural Characterization:

    • Determine high-resolution structures of M. guilliermondii TPC1 in different conformational states

    • Compare with structures from other species to identify unique features

    • Establish structure-function relationships through targeted mutagenesis

  • Comprehensive Functional Analysis:

    • Characterize transport kinetics under varying conditions

    • Identify regulatory mechanisms specific to fungal TPC1

    • Determine the role of TPC1 in M. guilliermondii metabolism and virulence

  • Development of Specific Research Tools:

    • Generate specific antibodies and activity assays

    • Establish genetically modified M. guilliermondii strains with TPC1 mutations

    • Create reconstitution systems for detailed mechanistic studies

Medium-Term Priorities:

  • Comparative Studies:

    • Compare TPC1 properties across Meyerozyma species (M. guilliermondii vs. M. caribbica)

    • Analyze differences between fungal and mammalian thiamine transporters

    • Investigate evolutionary relationships between transporters and channels

  • Systems-Level Integration:

    • Map the impact of TPC1 dysfunction on fungal metabolic networks

    • Identify compensatory mechanisms when TPC1 function is compromised

    • Determine interactions with other mitochondrial transporters and proteins

Long-Term Directions:

  • Therapeutic Applications:

    • Explore TPC1 as a potential antifungal target

    • Develop selective inhibitors of fungal TPC1

    • Investigate the role of TPC1 in antifungal resistance

  • Biotechnological Applications:

    • Engineer TPC1 for enhanced thiamine accumulation in biotechnology applications

    • Develop TPC1-based biosensors for metabolic studies

    • Explore applications in metabolic engineering

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.