Recombinant Meyerozyma guilliermondii Patatin-like phospholipase domain-containing protein PGUG_03164 (PGUG_03164)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
PGUG_03164; Patatin-like phospholipase domain-containing protein PGUG_03164
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-717
Protein Length
full length protein
Species
Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)
Target Names
PGUG_03164
Target Protein Sequence
MTSSTPLYDENEDYIDENHINTFAKALLWEDDDHDGLASPPLPAYEGDKLAEVNAEELSS VLTPEPNNESEKSRPEFVVSHNDWYPINAPEKSKAKADAKGRKKRASTRDEFRSSAAYTL LRWPFLIIITVWILLLCILYTVVRAYVALSEYMLTWVGERKVLRNKLRASKTYEEWIENA LELDRYLHLDKWSSIPRFSYYDYRTVKRTTSKLRMLRMRGMDEELMVFLQGCLKKNFAGI ENRQLYAHRYYGTKNVVHVYIDEVVASIDHVTESENITPEDKRRFFRSVSRNYGRTALCL SGGACFAYTHFGIVKALLDNDLLPSIITGTSGGGLVAALACTRTDDELKQLLVPRLARKI TACEDPWYVWIPRWWRTGARFDSTAWARKSNYFTLGSLTFQEAYHRTGRRLNISTVPADP HSPVILCNNITAPNCIIWSCLLASSAVPGILNPVVLMMKDSKKNTIVPFSLGSKWKDGSL RTDIPIDALKTYYNVNFTVVSQVNPHISLFFFAPKGSVGRPVASSRRKTRREKYASLRGG FIATALEHLFKLEIKKWLEMIKTLDLLPRLSESDWSSIWLQRFTGSITIWPRNNFRDFWY ILSDPSEEGLGEMIRKGERYMFPKILFLKHRLSIENAIERGRTKSKLSTAHLEHSPRFSG TPEFAGPEFQLQTVHYDDDYDSESSAEETLSPGFSQGTHAVLTDESDDDSSDDEIDD
Uniprot No.

Target Background

Function
Probable lipid hydrolase.
Database Links

KEGG: pgu:PGUG_03164

STRING: 4929.A5DIR3

Protein Families
PLPL family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of Meyerozyma guilliermondii PGUG_03164?

The PGUG_03164 protein is a patatin-like phospholipase domain-containing protein from Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324), also known as Candida guilliermondii. The full-length protein consists of 717 amino acids and contains the characteristic patatin domain which typically features a catalytic dyad (Ser-Asp) necessary for its phospholipase activity. The protein is cataloged in UniProt with the accession number A5DIR3 . The protein's enzymatic function is classified as EC 3.1.1.-, indicating it belongs to the hydrolase family acting on ester bonds, though its specific substrate preference within the phospholipase family requires further characterization.

How does PGUG_03164 relate structurally to other patatin-like phospholipase proteins?

BLAST analysis reveals that PGUG_03164 shows significant sequence similarity to several other patatin-like phospholipase domain-containing proteins across fungal species. Notably, it demonstrates homology with lipases such as triacylglycerol lipases and other patatin-like phospholipase domain-containing proteins with similarity scores ranging from approximately 123-154 in BLAST comparisons . This suggests conservation of core functional domains despite evolutionary divergence. A comparative sequence analysis shows particularly strong homology with patatin-like phospholipase domain-containing proteins from related fungal species, indicating potential functional conservation within this protein family.

What are the optimal storage conditions for maintaining recombinant PGUG_03164 stability?

For optimal stability, recombinant PGUG_03164 should be stored at -20°C for regular use, or at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which is optimized for protein stability . Importantly, repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity. For ongoing experiments, working aliquots can be maintained at 4°C for up to one week without significant degradation . When planning long-term studies, it is advisable to create multiple small-volume aliquots during initial thawing to minimize freeze-thaw damage to the protein structure.

What expression systems are most effective for producing recombinant PGUG_03164?

While the search results don't specify the exact expression system used for PGUG_03164, recombinant proteins from Meyerozyma guilliermondii are typically expressed in either yeast-based systems (such as Pichia pastoris or Saccharomyces cerevisiae) or bacterial systems (predominantly E. coli). For patatin-like proteins, which may require post-translational modifications for proper folding and activity, yeast expression systems often provide advantages. When designing expression experiments, researchers should consider codon optimization for the host system and inclusion of appropriate purification tags that don't interfere with the catalytic domain of the protein. Expression trials comparing yields and activity levels between different systems are recommended to determine optimal production conditions.

What enzymatic activities have been confirmed for PGUG_03164?

The PGUG_03164 protein belongs to the patatin-like phospholipase domain-containing protein family (EC 3.1.1.-), suggesting lipid hydrolase activity . While the specific substrates for this particular protein haven't been definitively characterized in the available research, patatin-like proteins typically exhibit phospholipase A2 activity, hydrolyzing the sn-2 position of phospholipids to release fatty acids. To determine precise substrate specificity, researchers should conduct activity assays using various lipid substrates including phosphatidylcholine, phosphatidylethanolamine, and triacylglycerols, while monitoring product formation through techniques such as thin-layer chromatography or mass spectrometry.

How can researchers distinguish PGUG_03164 from similar proteins in related Candida species?

Molecular techniques such as PCR-RFLP (polymerase chain reaction-restriction fragment length polymorphism) analysis and multiplex PCR assays have been developed to differentiate closely related Candida species including Meyerozyma guilliermondii (formerly Candida guilliermondii) . When designing experiments to study PGUG_03164 specifically, researchers should:

  • Use the internal transcribed spacer (ITS) regions of rDNA for species identification

  • Employ species-specific primer pairs targeting regions with high sequence divergence such as the IGS1 region

  • Consider intron length differences combined with species-specific amplification for reliable identification

  • Validate identification through sequencing of the ITS region

These approaches ensure that studies of PGUG_03164 are not confounded by homologous proteins from closely related species .

What bioinformatic approaches are recommended for analyzing the evolutionary history of PGUG_03164?

To investigate the evolutionary history of PGUG_03164, researchers should employ multiple sequence alignment tools (such as MUSCLE or CLUSTAL) to align the protein sequence with homologs from related species. Phylogenetic analysis using maximum likelihood or Bayesian methods can then be applied to construct evolutionary trees. BLAST analysis already indicates similarity to multiple patatin-like phospholipase domain-containing proteins across fungal species, with scores ranging from approximately 123-154 . Researchers should focus on analyzing:

  • Conservation patterns within the catalytic domain

  • Lineage-specific adaptations in substrate-binding regions

  • Selection pressure acting on different protein regions using dN/dS ratios

  • Potential horizontal gene transfer events between fungal lineages

What techniques are recommended for studying PGUG_03164 localization and expression patterns?

To investigate subcellular localization and expression patterns of PGUG_03164, researchers should consider:

  • Generating fluorescent protein fusions (GFP or mCherry) at either the N- or C-terminus, ensuring the tag doesn't interfere with the catalytic domain

  • Employing specific antibodies for immunofluorescence microscopy if available

  • Conducting real-time quantitative PCR to measure gene expression under various environmental conditions

  • Using reporter gene assays to identify promoter elements regulating expression

These approaches can reveal critical information about the protein's biological context and potential functions within the cell.

How can PGUG_03164 be used as a molecular marker for identifying Meyerozyma guilliermondii in clinical samples?

Based on molecular differentiation approaches for Meyerozyma species , PGUG_03164 could serve as a valuable species-specific marker. Researchers developing such applications should:

  • Design primers targeting unique regions of the PGUG_03164 gene that differ from homologs in related species

  • Develop a multiplex PCR assay incorporating these primers alongside universal fungal primers as controls

  • Validate the specificity against a panel of related Candida species commonly found in clinical samples

  • Determine detection limits using quantitative PCR with serial dilutions of purified DNA

This methodological approach would allow rapid and reliable identification of Meyerozyma guilliermondii in clinical specimens, facilitating studies on its prevalence and potential pathogenicity.

What methods are most effective for identifying binding partners of PGUG_03164?

To investigate protein interaction networks involving PGUG_03164, researchers should consider:

  • Affinity purification coupled with mass spectrometry (AP-MS) using tagged versions of PGUG_03164

  • Yeast two-hybrid screening against a Meyerozyma guilliermondii cDNA library

  • Proximity-labeling approaches such as BioID or APEX2 to identify proteins in close proximity to PGUG_03164 in vivo

  • Pull-down assays using recombinant PGUG_03164 as bait with cellular lysates

When interpreting results, researchers should compare interaction profiles with those of mammalian patatin-like phospholipases to identify conserved functional complexes.

How can researchers investigate the potential role of PGUG_03164 in pathogenicity?

Though Meyerozyma guilliermondii is generally considered less pathogenic than some Candida species, investigating PGUG_03164's potential role in virulence would involve:

  • Creating gene knockout or knockdown strains and assessing changes in adherence to host cells

  • Evaluating biofilm formation capabilities compared to wild-type strains

  • Measuring secreted enzyme activity profiles, particularly phospholipase activity

  • Conducting infection models using appropriate cell lines or animal models to assess virulence

These approaches would help determine whether PGUG_03164 contributes to the organism's ability to colonize hosts or cause infection.

What structural features are critical for PGUG_03164 enzymatic activity?

Based on knowledge of patatin-like phospholipase domains, researchers investigating structure-function relationships should focus on:

  • Identifying the catalytic dyad (typically Ser-Asp) through sequence alignment and site-directed mutagenesis

  • Characterizing the G-X-S-X-G motif essential for lipase activity

  • Analyzing substrate-binding regions through homology modeling and docking studies

  • Investigating the role of any accessory domains in regulating catalytic activity

Experimental validation through activity assays with purified mutant proteins is essential to confirm predictions from computational analyses.

How do post-translational modifications affect PGUG_03164 activity?

Though information about specific post-translational modifications of PGUG_03164 is limited in the provided search results, researchers should investigate:

  • Potential phosphorylation sites that may regulate activity, using mass spectrometry-based phosphoproteomic approaches

  • Glycosylation patterns that might affect protein stability or localization

  • Potential lipid modifications that could influence membrane association

  • Ubiquitination or SUMOylation events that might regulate protein turnover

A comprehensive understanding of these modifications would provide insight into the regulatory mechanisms controlling PGUG_03164 function in different cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.