Recombinant Meyerozyma guilliermondii Sensitive to high expression protein 9 homolog, mitochondrial (SHE9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SHE9; PGUG_02987; Sensitive to high expression protein 9 homolog, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-440
Protein Length
Full Length of Mature Protein
Species
Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)
Target Names
SHE9
Target Protein Sequence
IRLCAGRSQYLAATCTPSRFVNKFQVRSSSNSKNIDDKLQTIIDSSNLGAVKKQNEANNK SRNASDTVNDTNTAIPSSSETFHQANADEHTISESTKRAILAENPTLPSQRERLRTETSK RIETYLESLQKTIFRATRTLNDATGYSSIEGLKNEVEKLEIELRRAKTTVKECKKAYTDA ISVRSQSQQEVNELLTRKHNWSPSDLERFTELYRNDHTNEQLEAEAARKLTDAESKVDSI QLKLTQSILTRYHEEQIWSDKIRSASTWGTWVIMGINVLLFFVATLIVEPWKRKRLVASF EDKVKVAISEVNLSNTDSVVEKNTIPAPEASALNETSFSSQISLEPSLLSLSWSQWTWTK FSNYVKSTTSRVLYGNGEIQAIDARLLLVISTFLGCILGNILSGR
Uniprot No.

Target Background

Function
Essential for maintaining the structure of the mitochondrial inner membrane; involved in mitochondrial morphology. High overexpression induces growth arrest.
Database Links
Protein Families
SHE9 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Meyerozyma guilliermondii and its relationship to SHE9?

Meyerozyma guilliermondii is part of a species complex comprising M. guilliermondii, M. carpophila, and M. caribbica. It is a saprophytic yeast commonly found on human mucosa and skin, but can cause serious infections in immunocompromised patients . The SHE9 protein (Sensitive to high expression protein 9 homolog) in M. guilliermondii is a mitochondrial protein that, based on homology to Saccharomyces cerevisiae SHE9, likely plays a critical role in maintaining normal mitochondrial morphology and function .

What is known about the structure and localization of SHE9 in yeast species?

Based on research in S. cerevisiae, SHE9 is primarily localized to the inner mitochondrial membrane. The C-terminus of the protein has been identified as critically important for its function, as demonstrated in rescue experiments with she9Δ mutants . In terms of structure, the protein's domain spanning amino acids 36-440 appears to be functionally significant based on recombinant protein design parameters . The protein's specific structural motifs that enable its function in mitochondrial morphology regulation remain under investigation.

What expression systems are optimal for producing recombinant M. guilliermondii SHE9 protein?

For optimal expression of recombinant M. guilliermondii SHE9, E. coli-based expression systems have been employed successfully . When designing expression studies, researchers should consider that M. guilliermondii itself has been shown to be a viable host for heterologous protein expression. For example, M. guilliermondii strain SMB has been used successfully with a formaldehyde dehydrogenase promoter (PFLD1) system, demonstrating high efficiency in expressing recombinant proteins . For SHE9 specifically, expression protocols should account for its mitochondrial targeting sequence and membrane association properties, potentially requiring solubilization strategies during purification.

What are the critical considerations for maintaining the native conformation of SHE9 during purification?

When purifying recombinant SHE9, researchers must carefully consider its natural membrane-associated environment. Purification protocols should incorporate: (1) Appropriate detergents for solubilization that maintain protein structure without denaturation—mild non-ionic detergents such as digitonin or DDM are often suitable for mitochondrial membrane proteins; (2) Buffer conditions mimicking the mitochondrial intermembrane space environment regarding pH and ionic strength; (3) Inclusion of phospholipids during later purification stages to stabilize the protein, especially considering SHE9's potential involvement in phospholipid metabolism pathways ; and (4) Validation of proper folding through functional assays based on known activities in mitochondrial morphology regulation.

How can researchers experimentally determine the specific function of SHE9 in mitochondrial morphology?

To elucidate SHE9's specific function in mitochondrial morphology, researchers should employ a multi-faceted approach. First, create knockout/knockdown models in M. guilliermondii using CRISPR-Cas9 or RNA interference approaches, followed by detailed phenotypic characterization using confocal microscopy with mitochondrial-specific fluorescent dyes or tagged proteins to visualize morphological changes. Complementation studies using wild-type and mutated versions of SHE9 can identify essential functional domains. Time-lapse microscopy during mitochondrial stress conditions can reveal dynamic aspects of SHE9's role. Additionally, biochemical assays examining mitochondrial fission/fusion rates in the presence and absence of SHE9 provide functional data, while proteomic approaches including co-immunoprecipitation can identify interaction partners that place SHE9 within specific mitochondrial pathways .

What is known about the role of SHE9 in cellular metabolism and diauxic shift?

Studies in S. cerevisiae have demonstrated that she9Δ cells exhibit decreased growth during diauxic shift—when cells transition from fermentative metabolism (glycolysis) to respiratory metabolism (oxidative phosphorylation) . This suggests SHE9 plays a crucial role in adapting mitochondrial function during metabolic transitions. The precise mechanism remains under investigation, but bioinformatics analyses suggest potential interactions with proteins involved in phospholipid metabolism. Current models propose that under non-fermentable carbon sources, SHE9 may function as an inhibitor of the Ups1-independent cardiolipin accumulation pathway . To experimentally assess SHE9's metabolic roles in M. guilliermondii, researchers should conduct growth curve analyses in media with different carbon sources, measure oxygen consumption rates, and analyze mitochondrial membrane potential changes during metabolic transitions in wild-type versus she9Δ strains.

How does SHE9 interact with other proteins in mitochondrial membranes?

Bioinformatics analyses using tools like STRING and GeneMANIA have identified several potential genetic and physical interactors of SHE9 in yeast. Notable interactions include mitochondrial inner membrane (MIM) proteins Mdm31/Mdm32 and mitochondrial outer membrane (MOM) protein Por1, all of which play crucial roles in phospholipid metabolism . Experimental validation of these interactions in M. guilliermondii requires techniques such as proximity-dependent biotin identification (BioID) or split-GFP complementation assays specific for membrane proteins. Co-immunoprecipitation followed by mass spectrometry can identify the complete interactome. Functional validation through double knockout studies (she9Δ combined with deletions of identified interactors) would reveal genetic interactions and pathway relationships, similar to epistasis studies performed in S. cerevisiae .

What are the optimal conditions for studying SHE9 function during diauxic shift?

To optimally study SHE9 function during diauxic shift, researchers should design experiments that carefully control carbon source transitions. Initially, cultures should be grown in media containing glucose (2%) to establish fermentative metabolism. To induce diauxic shift, either allow natural glucose depletion (monitoring with glucose assays) or transfer cells to media containing non-fermentable carbon sources like glycerol (3%) . Time-course sampling before, during, and after the shift is critical for capturing dynamic changes. Key parameters to measure include growth rates (OD600), mitochondrial morphology (via fluorescence microscopy), oxygen consumption rates, ATP production, and expression levels of key respiratory genes. Comparison between wild-type and she9Δ strains provides functional insights, while phospholipid profiling during the transition (particularly PE and CL levels) can test the hypothesis that SHE9 regulates phospholipid metabolism during respiratory adaptation . Temperature should be maintained at the optimal growth temperature for M. guilliermondii (typically 28-30°C), and pH should be buffered to prevent confounding effects from media acidification.

How can phospholipid alterations be accurately measured in she9Δ mutants?

To accurately measure phospholipid alterations in she9Δ mutants of M. guilliermondii, researchers should implement a comprehensive lipidomic approach. First, isolate highly purified mitochondria using differential centrifugation followed by density gradient separation to avoid contamination from other cellular membranes. Extract lipids using modified Bligh and Dyer methods optimized for phospholipids. Quantitative analysis should employ thin-layer chromatography coupled with mass spectrometry (TLC-MS) or direct liquid chromatography-mass spectrometry (LC-MS/MS) for detailed profiling. Focus analysis on cardiolipin (CL) and phosphatidylethanolamine (PE) levels, which have been implicated in SHE9 function . Include internal standards for each phospholipid class for accurate quantification. Compare wild-type and she9Δ strains under both fermentable (glucose) and non-fermentable (glycerol) conditions, collecting samples at multiple time points during diauxic shift. Additionally, analyze acyl chain composition of phospholipids, as changes in saturation can impact membrane properties independently of total phospholipid levels.

What role might SHE9 play in the pathogenicity of M. guilliermondii infections?

M. guilliermondii can cause serious infections in immunocompromised patients, with increasing incidence in recent decades and concerning patterns of antifungal resistance . To investigate SHE9's potential role in pathogenicity, researchers should first develop she9Δ mutant strains and compare their virulence to wild-type in both in vitro and in vivo models. In vitro, assess adhesion to epithelial cells, biofilm formation capacity, and survival under oxidative stress conditions typical during immune response. In vivo, use established murine models of disseminated candidiasis to compare infection progression, fungal burden, and host survival rates. At the molecular level, examine whether SHE9 dysfunction affects established virulence factors including hyphal morphogenesis, secreted hydrolases, or stress response pathways. Given SHE9's role in mitochondrial function, particular attention should be paid to metabolic adaptability during infection, as pathogens must rapidly adjust to diverse nutrient environments within the host. Additionally, test antifungal susceptibility profiles of she9Δ mutants compared to wild-type, as mitochondrial function has been implicated in resistance mechanisms.

How does SHE9 function compare across the Meyerozyma guilliermondii species complex?

The M. guilliermondii species complex comprises M. guilliermondii, M. carpophila, and M. caribbica . To compare SHE9 function across this complex, researchers should first conduct comparative genomic analysis to identify SHE9 orthologs in each species and analyze sequence conservation, focusing on functional domains. Generate species-specific she9Δ mutants and compare phenotypes under identical conditions, particularly examining mitochondrial morphology, growth during diauxic shift, and phospholipid profiles. Cross-complementation experiments (expressing SHE9 from one species in she9Δ mutants of another) can reveal functional conservation or specialization. Given varying clinical significance across the complex, correlate SHE9 function with species-specific traits like antifungal resistance or virulence. This comparative approach may reveal evolutionary adaptations in mitochondrial function that contribute to niche specialization within the complex. Researchers should also examine expression patterns of SHE9 under various environmental conditions relevant to each species' ecology to identify regulatory divergence.

What are common pitfalls when working with recombinant M. guilliermondii SHE9 and how can they be addressed?

Working with recombinant M. guilliermondii SHE9 presents several potential challenges. First, protein aggregation or improper folding often occurs due to its mitochondrial membrane association. Researchers should optimize solubilization by testing different detergents (starting with milder options like digitonin) and consider fusion tags that enhance solubility (such as MBP or SUMO). Second, low expression yields can be addressed by codon optimization for the expression host and exploring temperature reduction during induction (16-20°C). Third, functional assays may be complicated by SHE9's complex role in mitochondrial dynamics; researchers should develop clear readouts like in vitro membrane remodeling assays or complementation of she9Δ phenotypes. Fourth, antibody specificity issues can arise; generate multiple antibodies against different epitopes and rigorously validate using she9Δ controls. Finally, potential toxicity when overexpressed can be managed through tightly regulated induction systems or by expressing separate functional domains rather than the full-length protein.

How can researchers effectively design domain-specific mutations to determine critical regions of SHE9?

To effectively design domain-specific mutations for functional analysis of SHE9, researchers should begin with thorough in silico analysis combining multiple approaches. First, perform comparative sequence analysis across fungal species to identify conserved domains, which often correspond to functionally critical regions. Second, use structure prediction tools to identify potential functional motifs such as transmembrane regions, lipid-binding domains, or protein-protein interaction interfaces. Based on these analyses, design a series of targeted mutations including: (1) Alanine-scanning mutagenesis of highly conserved residues; (2) Deletion of predicted functional domains; (3) Chimeric constructs swapping domains between SHE9 orthologs; and (4) Point mutations targeting residues predicted to be involved in specific functions (e.g., phospholipid binding). Each mutant should be validated for expression and localization, then assessed for its ability to complement she9Δ phenotypes, particularly mitochondrial morphology defects and growth during diauxic shift . Advanced techniques like BioID with mutant constructs can identify domain-specific interaction partners. This systematic approach will map the structure-function relationship of SHE9 domains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.