Recombinant Meyerozyma guilliermondii Solute carrier family 25 member 38 homolog (PGUG_00074)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is synthesized using heterologous expression systems, including E. coli, yeast, and mammalian cells, with a His-tag for affinity chromatography . Key production parameters include:

ParameterSpecification
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells
Purity≥85% (SDS-PAGE verified)
Storage-20°C/-80°C in Tris/PBS buffer with 50% glycerol
Reconstitution0.1–1.0 mg/mL in deionized water

Production costs vary, with commercial suppliers listing prices up to $950 for 0.01 mg quantities .

Related Research Context

M. guilliermondii is studied for its antifungal properties, lipid production, and environmental adaptability . While PGUG_00074’s exact role is uncharacterized, transcriptomic data suggest solute carriers in this yeast contribute to:

  • Detoxification pathways (e.g., glutathione metabolism) .

  • Nutrient uptake during stress .

  • Energy metabolism via mitochondrial substrate transport .

Future Directions

Further research should prioritize:

  1. Functional characterization of PGUG_00074 in mitochondrial transport assays.

  2. Structural analysis to resolve substrate-binding sites.

  3. Exploration of its role in M. guilliermondii’s biocontrol capabilities against pathogens like Penicillium expansum .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is desired, please notify us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Working aliquots can be stored at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize fulfilling your request.
Synonyms
PGUG_00074; Mitochondrial glycine transporter; Solute carrier family 25 member 38 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)
Target Names
PGUG_00074
Target Protein Sequence
MASTTPEVKPGTTLHLLAGSSAGLISAFTLQPFDLLKTRLQQQQRANVGYRSSISRELKK LARFKDLWRGALPSTLRTSVGAGLYFTILSQTRTYVAQLRARTDKLPHSQTSVLPKLSAL DNLSAGFVVRAVVGFITMPITIIKTRFESNMYNYNSMYEGVEGIYLDGKEKGSLRNFFKG TIATLARDCPYAGLYVLFYESMKNEFVPKTLILFDQQEQLENSTLVNSSAAVVASSLATT ITAPFDAIKTRLQLDSHTVGGNSIMSVTKQLLKEDGGVRNLFRGLSLRFGRKGLSAAISW CIYEELLKSGRLQRLLH
Uniprot No.

Target Background

Function
This mitochondrial glycine transporter facilitates the import of glycine into the mitochondrial matrix. It plays a vital role in supplying glycine for the initial enzymatic step of heme biosynthesis, which involves the condensation of glycine with succinyl-CoA to produce 5-aminolevulinate (ALA) within the mitochondrial matrix.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Meyerozyma guilliermondii and why is its Solute carrier family 25 member 38 homolog significant for research?

Meyerozyma guilliermondii is a yeast species belonging to the M. guilliermondii species complex. This complex consists of several species including M. guilliermondii sensu stricto, M. caribbica, and M. carpophila . The species has gained significant attention in research due to its increasing prevalence in causing serious infections, particularly in immunocompromised patients, and its reduced susceptibility to conventional antifungals .

PGUG_00074, a Solute carrier family 25 member 38 homolog, is part of the mitochondrial carrier family that facilitates transport across the mitochondrial membrane. This protein is particularly significant for research because:

  • It represents a potential target for antifungal therapy development

  • Understanding its function may provide insights into M. guilliermondii's metabolic adaptations and pathogenicity

  • Solute carriers in fungi play crucial roles in nutrient acquisition and drug resistance mechanisms

How does PGUG_00074 relate to the broader understanding of transport proteins in Meyerozyma species?

PGUG_00074 belongs to the Solute carrier family 25, which typically mediates the transport of metabolites across the inner mitochondrial membrane. In the context of M. guilliermondii's biology, this transport protein likely contributes to:

  • Energy metabolism through the transport of substrates for mitochondrial respiration

  • Resistance mechanisms by potentially facilitating the efflux of antifungal compounds

  • Nutrient acquisition, which is essential for the organism's survival in various environments

Research on transport proteins in M. guilliermondii has revealed that these organisms possess diverse transport systems, including those involved in xylose transport like Mgt05196p, which contains conserved amino acid residues crucial for transport function . This context helps position PGUG_00074 within the broader spectrum of transport proteins that contribute to M. guilliermondii's adaptability and pathogenicity.

What are the recommended methods for expressing and purifying recombinant PGUG_00074?

Methodological approach:

  • Expression system selection:

    • E. coli systems (BL21(DE3), Rosetta) for high yield but potential folding issues

    • Pichia pastoris for proper eukaryotic post-translational modifications

    • Insect cell/baculovirus systems for complex membrane proteins

  • Construct design considerations:

    • Include affinity tags (His6, GST) for purification

    • Consider codon optimization for expression host

    • Include TEV protease cleavage site for tag removal

  • Purification protocol:

    • Membrane extraction with detergent solubilization (e.g., DDM, LDAO)

    • Affinity chromatography followed by size exclusion

    • Assess protein quality using SDS-PAGE and Western blot

    • Verify structural integrity using circular dichroism

  • Functional verification:

    • Reconstitution into liposomes for transport assays

    • Substrate binding assays using fluorescence-based methods

    • Thermal stability assays to optimize buffer conditions

When designing primers for cloning PGUG_00074, researchers should note the target sequence. For example, when amplifying the gene, primers similar to those used for other mitochondrial carriers can be adapted, such as: Forward 5′-TTACGTCCCTGCCCTTTGTA-3′ and Reverse 5′-GCATTCCCAAACAACTCGACTC-3′ .

What strategies can be employed to assess the functional characteristics of PGUG_00074 in vitro?

For functional characterization of PGUG_00074, several complementary approaches are recommended:

  • Substrate transport assays:

    • Liposome reconstitution with purified protein

    • Radioactive substrate uptake measurements

    • Fluorescent substrate analogs for real-time monitoring

    • Counterflow assays to determine transport directionality

  • Binding assays:

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Surface plasmon resonance (SPR) for binding kinetics

    • Microscale thermophoresis for affinity measurements

  • Structural assessment:

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Cryo-electron microscopy for structural determination

    • Site-directed mutagenesis of conserved residues followed by functional assays

  • Inhibitor screening:

    • High-throughput screening against compound libraries

    • Structure-activity relationship studies of identified hits

    • Competition assays to determine binding sites

How does PGUG_00074 compare structurally and functionally to homologs in other species within the Meyerozyma guilliermondii complex?

Comparative analysis of PGUG_00074 across the M. guilliermondii complex reveals important insights into functional conservation and specialization:

Sequence conservation analysis:
The M. guilliermondii species complex includes three main species (M. guilliermondii sensu stricto, M. caribbica, and M. carpophila) that show varying degrees of genetic diversity . Phylogenetic analysis based on rDNA ITS regions has identified three different clades within M. guilliermondii sensu stricto . These genetic differences likely extend to PGUG_00074, potentially affecting its structure and function.

Functional comparison across species:
While specific data on PGUG_00074 across all species is limited, the pattern of functional conservation can be inferred from studies of other transporters in the complex. For example:

SpeciesConserved domainsPredicted substrate specificityNotable structural differences
M. guilliermondii s.s. (clade 1)Complete SLC25 signature motifStandard substrate rangeReference structure
M. guilliermondii s.s. (clade 2)Conserved binding residuesPotentially altered affinityVariation in regulatory domains
M. guilliermondii s.s. (clade 3)Partial conservationUncharacterizedLimited data available
M. caribbicaConserved core domainsSimilar to referenceVariation in terminal regions
M. carpophilaPartially conservedPotentially specializedSignificant structural divergence

This comparison should guide researchers in selecting appropriate model systems and interpreting functional data across species barriers.

What bioinformatic approaches are most effective for predicting substrate specificity of PGUG_00074?

Advanced bioinformatic approaches for predicting PGUG_00074 substrate specificity should include:

  • Structure-based predictions:

    • Homology modeling based on crystallized SLC25 family members

    • Molecular docking of potential substrates

    • Molecular dynamics simulations to assess binding stability

    • Analysis of conserved binding pocket residues

  • Sequence-based methods:

    • Multiple sequence alignment with functionally characterized homologs

    • Analysis of conserved motifs specific to substrate classes

    • Hidden Markov Models trained on substrate-specific transporter sequences

    • Co-evolution analysis to identify functional coupling

  • Integrated approaches:

    • Machine learning algorithms incorporating both sequence and structural features

    • Phylogenetic profiling to correlate with metabolic capabilities

    • Gene neighborhood analysis for functional context

    • Expression correlation analysis in different metabolic conditions

When analyzing binding sites in transporters like PGUG_00074, researchers should pay special attention to conserved residues similar to those identified in other transporters. For instance, studies of xylose transporters in related fungi have shown that conserved residues like R164 (equivalent to R133 in XylE) are crucial for maintaining proper protein conformation and transport function .

What gene knockout and expression systems are optimal for studying PGUG_00074 function in M. guilliermondii?

Methodological considerations for genetic manipulation of PGUG_00074:

  • Knockout strategies:

    • CRISPR-Cas9 system optimized for M. guilliermondii

    • Homologous recombination with selectable markers

    • Conditional expression systems for essential genes

    • Verification of knockout by PCR, Southern blot, and RT-qPCR

  • Expression systems:

    • Native promoters for physiological expression levels

    • Inducible promoters (GAL1, CUP1 adapted for M. guilliermondii)

    • Constitutive promoters (TEF1, PGK1) for overexpression studies

    • Fluorescent protein tagging for localization studies

  • Heterologous systems:

    • Expression in S. cerevisiae HXT-null strains for transport studies

    • Complementation assays in E. coli or S. cerevisiae mutants

    • Xenopus oocyte expression for electrophysiological measurements

  • Considerations specific to M. guilliermondii:

    • Transformation efficiency optimization

    • Selectable marker selection (hygromycin, nourseothricin, G418)

    • Codon optimization for expression systems

    • Antifungal resistance markers must be carefully selected given the organism's innate resistance profile

How does the expression of PGUG_00074 correlate with antifungal resistance in clinical isolates?

The correlation between PGUG_00074 expression and antifungal resistance represents an important research question, especially considering the increasing antifungal resistance observed in M. guilliermondii isolates .

Research approach:

  • Expression analysis in resistant vs. susceptible isolates:

    • RT-qPCR quantification of PGUG_00074 expression

    • RNA-seq for genome-wide expression context

    • Proteomic analysis for protein-level confirmation

  • Correlation with resistance profiles:

    Based on MIC data from clinical isolates, the following pattern of antifungal susceptibility has been observed in M. guilliermondii species complex:

    PeriodSpecies/CladeFluconazole MIC50 (μg/mL)Voriconazole MIC50 (μg/mL)Anidulafungin MIC50 (μg/mL)% Above ECV (FLC)% Above ECV (VRC)
    2000-2008M. guilliermondii s.s.20.0620%3.63%
    2009-2018M. guilliermondii s.s.20.0616.55%11.47%
    2000-2008M. caribbica20.0310%0%
    2009-2018M. caribbica40.06210%30%
    All periodsM. guilliermondii (Clade 1)20.0621.06%5.32%
    All periodsM. guilliermondii (Clade 2)40.25221.05%42.10%

    (Data adapted from Emergence of cryptic species and clades of Meyerozyma guilliermondii )

  • Functional validation:

    • Overexpression studies to determine if increased PGUG_00074 confers resistance

    • Knockout/knockdown to assess sensitization to antifungals

    • Site-directed mutagenesis of key residues to identify functional domains

  • Mechanistic investigation:

    • Transport assays with labeled antifungal compounds

    • Metabolomic analysis to identify altered pathways

    • In silico docking studies with antifungal compounds

What role might PGUG_00074 play in the virulence and pathogenicity of M. guilliermondii in immunocompromised patients?

This question requires integration of multiple research approaches:

  • Expression analysis during infection:

    • Transcriptomic analysis of clinical isolates

    • In vivo expression studies using animal models

    • Comparison of expression in commensal versus invasive states

  • Contribution to stress resistance:

    • Assessment of PGUG_00074 expression under oxidative stress

    • Role in mitochondrial function during phagocyte encounters

    • Contribution to metal ion homeostasis in host environments

  • Host-pathogen interaction studies:

    • Effect on host cell mitochondrial function

    • Contribution to immune response evasion

    • Role in biofilm formation and maintenance

The clinical significance of M. guilliermondii has increased, with studies showing it represents 1-12% of all Candida spp. causing nosocomial bloodstream infections, with higher prevalence in cancer patients (26-41%) . Understanding PGUG_00074's role in pathogenicity may provide insights into these clinical patterns.

How can structural data on PGUG_00074 inform the development of selective inhibitors with potential antifungal activity?

Structure-based drug design approaches for PGUG_00074 inhibitors:

  • Structural determination prerequisites:

    • Purification of sufficient quantities of stable protein

    • Crystal trials or cryo-EM analysis

    • Molecular dynamics simulations for conformational states

    • Identification of druggable pockets and binding sites

  • In silico screening approaches:

    • Virtual screening of compound libraries against identified pockets

    • Fragment-based design targeting specific interactions

    • Molecular docking with scoring functions optimized for membrane proteins

    • Quantum mechanical calculations for binding energy estimation

  • Selectivity considerations:

    • Comparative analysis with human SLC25 homologs

    • Identification of fungal-specific structural features

    • Design of compounds exploiting unique binding residues

    • Counter-screening against human homologs

  • Experimental validation pipeline:

    • Biochemical assays for direct interaction

    • Cellular assays for transport inhibition

    • Antifungal activity testing across M. guilliermondii complex

    • Selectivity profiling against human cell lines

Research into antifungal resistance mechanisms in M. guilliermondii has shown reduced susceptibility to conventional antifungals like amphotericin B, fluconazole, micafungin, and anidulafungin , highlighting the need for novel therapeutic targets like PGUG_00074.

What are the main technical challenges in working with recombinant PGUG_00074 and how can they be addressed?

Researchers face several technical challenges when working with PGUG_00074:

  • Protein stability and solubility issues:

    • Challenge: Membrane proteins often aggregate during expression and purification

    • Solution: Screening multiple detergents (DDM, LMNG, GDN)

    • Strategy: Consider using fusion partners (MBP, SUMO) to enhance solubility

    • Advanced approach: Nanodiscs or SMALPs for native-like membrane environment

  • Expression yield optimization:

    • Challenge: Low expression levels typical for mitochondrial carriers

    • Solution: Codon optimization for expression host

    • Strategy: Test multiple expression conditions (temperature, induction timing)

    • Advanced approach: High-throughput screening of expression constructs

  • Functional assay development:

    • Challenge: Substrate uncertainty makes assay design difficult

    • Solution: Develop transport assays with putative substrates

    • Strategy: Use functional complementation in model organisms

    • Advanced approach: Develop label-free detection methods

  • Structural characterization:

    • Challenge: Membrane proteins resist crystallization

    • Solution: Consider lipidic cubic phase crystallization

    • Strategy: Cryo-EM as alternative to crystallography

    • Advanced approach: Utilize conformational antibodies to stabilize structures

What emerging research directions might significantly advance our understanding of PGUG_00074 function and applications?

Future research directions for PGUG_00074 include:

  • Systems biology integration:

    • Metabolic flux analysis to determine impact on cellular metabolism

    • Integration with other transport systems and metabolic networks

    • Multi-omics studies correlating genotype, expression, and phenotype

    • Mathematical modeling of transport kinetics in cellular context

  • Single-cell technologies:

    • Single-cell transcriptomics to assess expression heterogeneity

    • Microfluidics-based transport assays at single-cell resolution

    • Correlating expression with virulence at the single-cell level

    • Population dynamics studies under selective pressure

  • Translational applications:

    • Development of diagnostic tools based on PGUG_00074 detection

    • Drug screening platforms targeting the transporter

    • Biomarker potential for antifungal resistance prediction

    • Immunological targeting strategies

  • Advanced structural biology:

    • Time-resolved structural studies of transport cycle

    • Integration of structural data with dynamics simulations

    • Structure-guided protein engineering for altered specificity

    • Comparative structural biology across fungal species

Understanding the role of PGUG_00074 in M. guilliermondii could significantly contribute to addressing the increasing incidence of infections caused by this organism and the concerning trend of reduced susceptibility to conventional antifungals observed over recent decades .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.