Recombinant Meyerozyma guilliermondii Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Meyerozyma guilliermondii Vacuolar ATPase Assembly Integral Membrane Protein VMA21

Recombinant Meyerozyma guilliermondii VMA21 is a synthetic version of the endoplasmic reticulum (ER)-resident protein critical for assembling the vacuolar-type H⁺-ATPase (V-ATPase). This enzyme facilitates proton transport across cellular membranes, essential for organelle acidification and cellular homeostasis. The recombinant form is produced via heterologous expression systems (e.g., E. coli, yeast, baculovirus, or mammalian cells) and is purified to ≥85% homogeneity, as determined by SDS-PAGE .

Gene and Organism Context

  • Gene ID: PGUG_02534

  • Organism: Meyerozyma guilliermondii (formerly Candida guilliermondii), a yeast-like fungus isolated from human infections, marine environments, and industrial products .

  • Protein Class: Integral membrane protein with a predicted role in V-ATPase assembly, analogous to yeast VMA21p .

Role in V-ATPase Assembly (Inferred from Homologs)

In yeast, VMA21p interacts with V₀ subunits (e.g., proteolipid subunits and Vph1p) to mediate V₀ domain assembly in the ER . This process is critical for proton transport and lysosomal function. While Meyerozyma’s VMA21 has not been directly studied, its structural conservation implies analogous roles:

  1. Chaperoning V₀ Subunits: Facilitating interactions between proteolipid rings and the 100-kDa V₀ subunit .

  2. ER Export Coordination: Escorting assembled V₀ complexes to the Golgi for V₁ domain integration .

Experimental Uses

ApplicationRationale
Structural StudiesCrystallization or cryo-EM to resolve V₀ assembly mechanisms.
Protein Interaction AssaysCo-IP or yeast two-hybrid to map binding partners (e.g., ATP6AP2, V₀ subunits) .
Disease ModelingInvestigating V-ATPase dysfunction in Meyerozyma or pathogenic fungi .

Clinical Relevance:

  • VMA21 mutations in humans cause X-linked myopathy with excessive autophagy (XMEA) . While Meyerozyma’s VMA21 is not directly implicated in human disease, its recombinant form could model V-ATPase-related pathologies.

Research Gaps and Future Directions

  • Functional Validation: No studies confirm Meyerozyma VMA21’s role in V-ATPase assembly.

  • Interaction Mapping: Lack of data on binding partners (e.g., ATP6AP2 homologs).

  • Therapeutic Potential: Unexplored applications in antifungal drug development or biotechnology.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare the protein according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
VMA21; PGUG_02534; Vacuolar ATPase assembly integral membrane protein VMA21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-73
Protein Length
full length protein
Species
Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)
Target Names
VMA21
Target Protein Sequence
MSLILIRSVVRKLVFFTAAMIIFPVFTFFVVQYLSDNALVSGGIAALAANVVLIGYVVAA FTEDTAALEKKEQ
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.