Recombinant Micaelamys namaquensis Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Micaelamys namaquensis (Namaqua rock rat) (Aethomys namaquensis)
Target Names
Target Protein Sequence
MAYPLQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAAILVLIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVSSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI
Uniprot No.

Target Background

Function
Recombinant *Micaelamys namaquensis* Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation, a process essential for cellular energy production. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme a of subunit 1 to the active site (a binuclear center composed of heme a3 and CuB) in subunit 1. This binuclear center reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Micaelamys namaquensis Cytochrome c oxidase subunit 2 (MT-CO2) and why is it significant for research?

Micaelamys namaquensis Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrially-encoded protein that forms part of the electron transport chain's complex IV in the Namaqua rock mouse (also known as Aethomys namaquensis). This protein has significant research value as it provides insights into both evolutionary relationships and metabolic adaptations in this widely distributed southern African murine rodent. MT-CO2 is particularly valuable for understanding the species complex nature of M. namaquensis, which shows substantial genetic differentiation across its range . The complete amino acid sequence of this protein consists of 227 amino acids, with characteristic domains that facilitate electron transport and cellular respiration .

Research using this protein contributes to our understanding of rodent phylogenetics, adaptation to various biomes, and potentially the mechanisms of speciation in southern African murine rodents.

How does MT-CO2 relate to the evolutionary history of Micaelamys namaquensis?

MT-CO2, like other mitochondrial proteins, serves as an important molecular marker for evolutionary studies. In Micaelamys namaquensis, mitochondrial DNA analysis has revealed substantial genetic differentiation that contradicts morphometric classifications. While cranial morphometric analysis suggests only four subspecies, mitochondrial DNA studies show at least eight distinct lineages or haplogroups (labeled A-H) . These lineages show varying degrees of diversity and are often associated with particular vegetation biomes of southern Africa.

The divergence time between these lineages, calculated using coalescent-based approaches, ranges from relatively recent (813,000 years ago [0.22-1.36 million years]) to much older (4.06 million years ago [1.21-4.47 million years]) . This indicates that Micaelamys namaquensis represents a species complex that radiated during the Pliocene and Pleistocene periods, coinciding with major aridification events and the expansion of savanna habitats in Africa .

How does the MT-CO2 of Micaelamys namaquensis compare with that of related species?

When comparing MT-CO2 between Micaelamys namaquensis and related species such as Arvicanthis somalicus (Somali grass rat), we can observe both conservation and divergence that reflect evolutionary relationships and adaptive modifications.

SpeciesUniProt IDAmino Acid LengthSelected Sequence Differences
Micaelamys namaquensisQ38S41227Position 31: I, Position 119: A, Position 200: F
Arvicanthis somalicusQ38S26227Position 31: I, Position 119: I, Position 200: Y

Notable differences in the amino acid sequence (shown partially in the table above) can be observed between these species, which may reflect adaptations to different ecological niches. For instance, M. namaquensis shows nocturnal adaptation as evidenced by its retinal structure with a cone to rod ratio of 1:12.4 , while Arvicanthis species are generally diurnal.

The comparison of MT-CO2 sequences can provide insights into the evolutionary relationships among murine rodents and potentially correlate with adaptations to specific environmental conditions or behavioral patterns.

What experimental approaches are most effective for functional characterization of recombinant Micaelamys namaquensis MT-CO2?

For functional characterization of recombinant Micaelamys namaquensis MT-CO2, researchers should consider a multi-faceted approach:

For optimal results, protein storage considerations are critical: use Tris-based buffer with 50% glycerol at -20°C, and avoid repeated freeze-thaw cycles by creating working aliquots stored at 4°C for up to one week .

How can recombinant MT-CO2 contribute to resolving phylogenetic relationships within the Micaelamys namaquensis species complex?

Recombinant MT-CO2 can serve as a powerful tool for resolving phylogenetic relationships within the M. namaquensis species complex through several methodological approaches:

  • Antibody-Based Lineage Differentiation: Developing antibodies against lineage-specific epitopes of recombinant MT-CO2 can allow for immunological differentiation of the eight identified haplogroups (A-H) . This approach requires:

    • Identification of lineage-specific amino acid substitutions

    • Production of monoclonal antibodies targeting these regions

    • Validation using known samples from different haplogroups

  • Protein Structure Comparison: Structural differences in MT-CO2 among lineages may reveal functional adaptations to different biomes. This requires:

    • Expression and purification of recombinant MT-CO2 from representative samples of each lineage

    • Comparative structural analysis using biophysical techniques

    • Correlation of structural differences with ecological parameters

  • Functional Divergence Analysis: Examining enzymatic properties of MT-CO2 variants can reveal adaptive differences:

    • Comparison of enzymatic activity under different temperature and pH conditions

    • Assessment of oxygen affinity in variants from different ecological zones

    • Evaluation of protein stability differences that may reflect environmental adaptations

These approaches can help resolve the apparent contradiction between morphometric classification (four subspecies) and genetic evidence (eight lineages), potentially clarifying the speciation processes in regions where distinct lineages occur in sympatry .

What experimental challenges must be addressed when working with Micaelamys namaquensis MT-CO2 in comparative studies of mitochondrial function?

Researchers working with M. namaquensis MT-CO2 in comparative studies face several methodological challenges:

  • Standardization Across Lineages: With eight distinct lineages identified , ensuring standardized isolation and characterization protocols is essential for valid comparisons. This requires:

    • Development of lineage-specific isolation methods

    • Standardized activity assays that account for genetic variation

    • Careful documentation of source populations and their ecological context

  • Integration with Nuclear-Encoded Subunits: MT-CO2 functions within the cytochrome c oxidase complex, which includes nuclear-encoded subunits. Research challenges include:

    • Ensuring compatible subunit interactions when studying recombinant MT-CO2

    • Accounting for co-evolutionary patterns between mitochondrial and nuclear genomes

    • Developing reconstitution protocols for functional enzyme complexes

  • Technical Considerations for Membrane Protein Analysis:

    • Preventing protein aggregation during purification (use Tris-based buffer with 50% glycerol)

    • Maintaining native structure in detergent-solubilized state

    • Developing reproducible reconstitution protocols in lipid bilayers

  • Physiological Context Integration: Correlating molecular findings with physiological adaptations requires:

    • Tissue-specific expression analysis across different lineages

    • Correlation with metabolic parameters relevant to nocturnal lifestyle

    • Integration with other adaptations, such as the visual system's rod-dominated retina (cone to rod ratio of 1:12.4)

Addressing these challenges requires careful experimental design and interdisciplinary approaches combining molecular biology, biochemistry, and ecological physiology.

How might variations in MT-CO2 correlate with adaptive radiation of Micaelamys namaquensis across different southern African biomes?

The eight distinct lineages of M. namaquensis show statistical associations with particular vegetation biomes of southern Africa , suggesting potential adaptive significance of MT-CO2 variations. A comprehensive research approach would include:

  • Sequence-Environment Correlation Analysis:

    • Identification of specific amino acid substitutions that correlate with environmental parameters

    • Statistical analysis of selection signatures on MT-CO2 codons

    • Comparative analysis of substitution rates in different protein domains

  • Functional Implications of Lineage-Specific Variations:

    • Temperature-dependent enzyme kinetics of lineage-specific MT-CO2 variants

    • Oxygen affinity characteristics related to altitude adaptation

    • Protein stability measures correlated with environmental stressors

  • Integrated Physiological Assessment:

    • Correlation of MT-CO2 variations with metabolic rates in different populations

    • Analysis of mitochondrial efficiency across temperature gradients

    • Evaluation of adaptive responses to seasonal environmental changes

The time frame of divergence between lineages (813 Kya to 4.06 Mya) coincides with major periods of aridification and expansion of savanna habitats, suggesting that MT-CO2 variations may reflect adaptations to these changing environments. Regions where distinct lineages occur in sympatry offer particularly valuable opportunities to study the role of MT-CO2 in local adaptation versus neutral divergence.

What methodological approaches can determine the role of MT-CO2 in the metabolic adaptation of Micaelamys namaquensis to its nocturnal lifestyle?

M. namaquensis exhibits a nocturnal lifestyle, as evidenced by its retinal structure with a cone to rod ratio of 1:12.4 . Investigating the role of MT-CO2 in supporting this lifestyle requires integrated methodological approaches:

  • Comparative Respiratory Chain Analysis:

    • Measurement of cytochrome c oxidase activity in M. namaquensis versus diurnal relatives

    • Oxygen consumption rates under conditions mimicking nocturnal activity patterns

    • ATP production efficiency comparisons between nocturnal and diurnal species

  • Thermal Adaptation Assessment:

    • Activity and stability profiles of MT-CO2 across temperature ranges experienced during nocturnal foraging

    • Comparative analysis with the diurnal rodent Rhabdomys pumilio, which shows different retinal adaptations

    • Cold adaptation characteristics of the electron transport chain

  • Tissue-Specific Expression and Activity Protocols:

    • Quantification of MT-CO2 expression in metabolically active tissues

    • Correlation of MT-CO2 activity with daily rhythms of activity and rest

    • Integration with other metabolic adaptations supporting nocturnal lifestyle

  • Experimental Design for Metabolic Flexibility Analysis:

    • Response of MT-CO2 to varying oxygen tensions

    • Metabolic substrate preference under different environmental conditions

    • Adaptation to seasonal changes in temperature and resource availability

These methodological approaches can help elucidate how MT-CO2 contributes to the metabolic underpinnings of nocturnal adaptation in M. namaquensis, potentially revealing molecular mechanisms that support activity patterns, thermoregulation, and energy conservation strategies in this species.

What protocols ensure optimal expression and purification of recombinant Micaelamys namaquensis MT-CO2 for structural studies?

Optimizing expression and purification of recombinant M. namaquensis MT-CO2 for structural studies requires careful consideration of several factors:

  • Expression System Selection and Optimization:

    • E. coli systems have been successfully used for similar proteins , but may require specialized strains for membrane proteins

    • Codon optimization based on M. namaquensis MT-CO2 sequence (Q38S41)

    • Expression temperature optimization (typically 16-20°C for membrane proteins)

    • Induction conditions that balance yield and proper folding

  • Purification Strategy:

    • Initial solubilization with mild detergents (n-dodecyl β-D-maltoside is often effective)

    • Immobilized metal affinity chromatography using His-tag

    • Size exclusion chromatography to ensure monodispersity

    • Optional: Ion exchange chromatography for additional purity

  • Stability Enhancement Considerations:

    • Buffer composition: Tris-based buffer with 50% glycerol, pH 8.0

    • Addition of stabilizing agents (glycerol, specific lipids)

    • Avoiding repeated freeze-thaw cycles by creating working aliquots

    • Storage at -20°C/-80°C for long-term preservation

  • Quality Control Assessments:

    • SDS-PAGE with greater than 90% purity target

    • Western blot confirmation of identity

    • Circular dichroism to verify secondary structure

    • Activity assays to confirm functional integrity

For reconstitution after lyophilization, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage .

How can researchers effectively use MT-CO2 as a molecular marker for studying population structure in Micaelamys namaquensis?

MT-CO2 can serve as an effective molecular marker for studying population structure in M. namaquensis through the following methodological approaches:

  • Primer Design and Sequencing Strategy:

    • Design of conserved primers flanking variable regions of MT-CO2

    • Nested PCR approaches for difficult samples

    • Next-generation sequencing for population-level analyses

    • Development of lineage-specific SNP panels

  • Analytical Framework for Population Structure Assessment:

    • Phylogenetic analysis methods to identify major lineages

    • Population genetics statistical approaches (Fst, AMOVA)

    • Haplotype network construction to visualize relationships

    • Bayesian assignment methods to detect admixture between lineages

  • Integration with Geographic and Ecological Data:

    • Spatial analysis of genetic variation across the species' range

    • Correlation with vegetation biomes of southern Africa

    • Identification of potential barriers to gene flow

    • Detection of contact zones between distinct lineages

  • Temporal Dynamics Investigation:

    • Calibration of molecular clock for MT-CO2 in murine rodents

    • Estimation of divergence times between populations

    • Reconstruction of historical demographic processes

    • Integration with paleoclimatic data from the Pliocene and Pleistocene

Previous research has already demonstrated the utility of mitochondrial DNA in identifying at least eight lineages in M. namaquensis , with MT-CO2 serving as an excellent complementary marker to the frequently used cytochrome b gene.

What experimental approaches can elucidate potential functional differences in MT-CO2 variants across the eight identified lineages of Micaelamys namaquensis?

Investigating functional differences in MT-CO2 variants across the eight identified lineages requires systematic approaches:

  • Comparative Enzyme Kinetics Protocol:

    • Expression of recombinant MT-CO2 from each lineage

    • Standardized assays for cytochrome c oxidation activity

    • Determination of Km and Vmax parameters under varying conditions

    • Inhibitor sensitivity profiles to detect functional adaptations

  • Structural Biology Approaches:

    • Homology modeling based on crystallographic data from related species

    • Identification of lineage-specific amino acid substitutions in functional domains

    • Molecular dynamics simulations to predict functional implications

    • Experimental validation through site-directed mutagenesis

  • Physiological Integration Methods:

    • Isolation of intact mitochondria from different lineages

    • Respiration measurements under standardized conditions

    • Proton pumping efficiency determination

    • Correlation with habitat-specific environmental parameters

  • Adaptive Significance Assessment:

    • Statistical tests for selection signatures on specific codons

    • Correlation of variants with ecological factors (temperature, altitude, aridity)

    • Experimental evolution approaches under controlled environmental conditions

    • Comparative analysis with other mitochondrial and nuclear genes

These approaches would be particularly valuable when applied to lineages found in different biomes or to populations from regions of sympatry where different lineages co-occur, as these situations provide natural experiments for understanding the adaptive significance of MT-CO2 variation .

How can insights from Micaelamys namaquensis MT-CO2 inform broader studies of mitochondrial adaptation in mammals?

M. namaquensis provides an excellent model for studying mitochondrial adaptation due to its diversification across multiple biomes and the presence of at least eight distinct lineages . Interdisciplinary approaches to leverage this system include:

  • Comparative Genomics Framework:

    • Sequence comparison of MT-CO2 across mammalian taxa from similar ecological niches

    • Identification of convergent adaptations in unrelated species

    • Analysis of co-evolution between mitochondrial and nuclear genomes

    • Detection of selection signatures across environmental gradients

  • Integrative Physiological Approaches:

    • Correlation of MT-CO2 variants with metabolic rates and thermoregulatory strategies

    • Assessment of mitochondrial efficiency across temperature ranges

    • Comparison of nocturnal adaptations with other nocturnal mammals

    • Integration with data on retinal adaptations (rod-cone ratios)

  • Ecological Energetics Research Protocol:

    • Field measurements of energy expenditure in different populations

    • Laboratory determination of metabolic efficiency

    • Correlation of mitochondrial function with activity patterns

    • Modeling of energetic constraints in different environments

  • Evolutionary Medicine Applications:

    • Insights into mitochondrial adaptations relevant to human health

    • Understanding mechanisms of metabolic adaptation that may inform disease research

    • Investigation of mitochondrial responses to environmental stressors

    • Potential applications for mitochondrial disorders research

The diversification timeline of M. namaquensis lineages (813 Kya to 4.06 Mya) offers the opportunity to study adaptation processes at different time scales, providing insights into both rapid adaptation and long-term evolutionary change in mammalian mitochondrial function.

What collaborative research approaches could integrate MT-CO2 studies with investigations of sensory adaptations in Micaelamys namaquensis?

Integrating MT-CO2 studies with investigations of sensory adaptations, particularly the visual system, offers rich opportunities for understanding nocturnal adaptation:

  • Metabolic-Sensory Integration Protocol:

    • Correlation of MT-CO2 variants with retinal structure and function

    • Energy budget allocation between sensory systems and other physiological processes

    • ATP requirements of rod-dominated retinas (cone to rod ratio of 1:12.4)

    • Comparative analysis with diurnal species like Rhabdomys pumilio (cone to rod ratio of 1:1.23)

  • Developmental Energetics Investigation:

    • MT-CO2 expression during retinal development

    • Energetic costs of developing and maintaining sensory systems

    • Correlation between mitochondrial efficiency and sensory acuity

    • Trade-offs between investments in different sensory modalities

  • Multidisciplinary Field and Laboratory Approaches:

    • Integration of field behavior, sensory physiology, and molecular biology

    • Experimental manipulation of energy budgets and observation of sensory compromises

    • Real-time monitoring of ATP consumption during sensory processing

    • Correlation of MT-CO2 variants with sensory-guided behaviors

  • Evolutionary Sequence Analysis Framework:

    • Correlation of selection signatures on MT-CO2 with genes involved in visual processing

    • Identification of co-evolutionary patterns between energy production and sensory systems

    • Comparative analysis across lineages with different sensory adaptations

    • Molecular dating of adaptations in both systems

These integrated approaches would help elucidate how energy production systems (involving MT-CO2) have co-evolved with energy-consuming systems (such as the visual apparatus) to support the nocturnal lifestyle of M. namaquensis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.