Recombinant Microcebus griseorufus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Complex I

MT-ND4L is a core subunit of Complex I (NADH:ubiquinone oxidoreductase), which catalyzes:

  1. Electron Transfer: NADH → FMN → Fe-S clusters → ubiquinone (CoQ10) .

  2. Proton Pumping: Four protons translocated per NADH oxidized, driving ATP synthesis .

Key functional regions include:

  • Transmembrane Helices: Critical for proton channel formation .

  • Overlap with MT-ND4: In humans, a 7-nucleotide overlap between MT-ND4L and MT-ND4 genes ensures coordinated translation .

Research Applications

Recombinant MT-ND4L is utilized in:

  1. Disease Modeling:

    • Study of Leber’s Hereditary Optic Neuropathy (LHON), linked to mutations like Val65Ala in humans .

    • Investigating mitochondrial disorders (e.g., Leigh syndrome) tied to Complex I dysfunction .

  2. Structural Studies:

    • Cryo-EM analyses of Complex I assembly and conformational states (e.g., active vs. deactive forms) .

  3. Drug Screening: Targeting proton-pumping mechanisms for metabolic disease therapies .

Production and Purification Workflow

The recombinant protein is generated via:

  1. Cloning: Full-length MT-ND4L gene insertion into E. coli vectors .

  2. Expression: Induced under optimized bacterial culture conditions .

  3. Purification: Affinity chromatography (His-tag) followed by lyophilization .

StepKey Parameters
LyophilizationTrehalose preserves protein stability
Storage-20°C/-80°C; avoid freeze-thaw cycles

Clinical and Evolutionary Relevance

  • LHON Association: The Val65Ala mutation disrupts proton translocation in humans, though mechanistic details remain unresolved .

  • Species-Specific Features: Microcebus griseorufus MT-ND4L provides insights into primate mitochondrial evolution and adaptation .

Limitations and Future Directions

  • Functional Studies: Structural differences between mouse lemur and human MT-ND4L may limit direct disease modeling .

  • Cryo-EM Advancements: High-resolution structures (e.g., 3.3 Å in mice ) could refine mechanistic understanding of this subunit.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Microcebus griseorufus (Gray-brown mouse lemur)
Target Names
Target Protein Sequence
MPSISINITLAFTAALLGMLMFRSHMMSSLLCLEGMMLSMFILSTLIILNTQFTMSFIMP ILLLVFAACEAAIGLALLVMVSNTYGLDHIQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.