Recombinant Microcebus murinus Suppressor of tumorigenicity 7 protein (ST7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
ST7; Suppressor of tumorigenicity 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Microcebus murinus (Lesser mouse lemur) (Gray Mouse Lemur)
Target Names
ST7
Target Protein Sequence
MAEAATGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMIDIFYSTELRDWNCKSIFMRIEDELEIPPAPQSQHFPN
Uniprot No.

Target Background

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Microcebus murinus Suppressor of Tumorigenicity 7 protein (ST7)?

Microcebus murinus (Lesser mouse lemur or Gray Mouse Lemur) Suppressor of Tumorigenicity 7 protein (ST7) is a full-length protein (585 amino acids) that belongs to the tumor suppressor family. The recombinant version is typically expressed in E. coli with an N-terminal His tag for purification purposes. ST7 has been identified as a candidate tumor suppressor gene in various species, with the Microcebus murinus variant providing important evolutionary insights into tumor suppression mechanisms across primates .

The protein's structure contains transmembrane domains and regions involved in protein-protein interactions that are critical for its tumor suppressive functions. In its recombinant form, researchers can study the protein's structure-function relationships in controlled laboratory settings.

How does Microcebus murinus ST7 compare evolutionarily to human ST7?

Evolutionary comparison studies between Microcebus murinus ST7 and human ST7 reveal important conservation patterns across primates. While several primates, including Microcebus murinus, lack certain isoforms that are present in humans, the core functional domains show considerable conservation .

This evolutionary divergence provides researchers with valuable comparative models to study the functional evolution of tumor suppressor genes. Understanding these differences helps elucidate how tumor suppression mechanisms have evolved across primate species and potentially identify conserved regions that are critical for the protein's function.

What expression systems are optimal for producing Recombinant Microcebus murinus ST7?

The optimal expression system for Recombinant Microcebus murinus ST7 is E. coli, as evidenced by commercial production methods . This bacterial expression system offers several advantages for ST7 production:

  • High protein yield

  • Cost-effectiveness

  • Relatively simple purification process using affinity chromatography

  • Ability to incorporate an N-terminal His-tag for purification

When designing expression constructs, researchers should consider:

  • Codon optimization for E. coli

  • Inclusion of appropriate promoter systems (T7 is commonly used)

  • Design of purification tags that minimize interference with protein function

  • Expression conditions that minimize inclusion body formation

For applications requiring post-translational modifications, alternative expression systems such as mammalian or insect cells may be considered, though these are not commonly used for standard ST7 production.

What are the recommended storage and reconstitution protocols for Recombinant Microcebus murinus ST7?

Storage Protocol:

  • Store lyophilized Recombinant Microcebus murinus ST7 at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Repeated freezing and thawing is not recommended

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is the default recommendation)

  • Aliquot for long-term storage at -20°C/-80°C

This reconstitution approach preserves protein stability and function while minimizing aggregation or degradation. Proper reconstitution is critical for downstream applications such as biochemical assays or structural studies.

What purification techniques are most effective for isolating Recombinant Microcebus murinus ST7?

The most effective purification technique for Recombinant Microcebus murinus ST7 leverages the N-terminal His-tag commonly incorporated into the recombinant construct. The recommended purification workflow includes:

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Ni-NTA or Co-NTA resins are ideal for capturing His-tagged ST7

    • Optimize imidazole concentrations in binding and elution buffers

  • Size Exclusion Chromatography (SEC):

    • Secondary purification step to remove aggregates and ensure monodispersity

    • Useful for buffer exchange into final storage buffer

  • Quality Control:

    • SDS-PAGE analysis to confirm >90% purity

    • Western blot using anti-His antibodies or specific anti-ST7 antibodies

This multi-step purification approach consistently yields high-purity protein suitable for biochemical and structural studies.

What methods are recommended for analyzing ST7 protein-protein interactions?

For comprehensive analysis of ST7 protein-protein interactions, researchers should consider a multi-method approach:

  • Co-Immunoprecipitation (Co-IP):

    • Use anti-His antibodies to pull down recombinant ST7 and identify interacting partners

    • Alternatively, use specific antibodies against potential binding partners

  • Yeast Two-Hybrid (Y2H) Screening:

    • Construct ST7 bait vectors to screen for novel interacting proteins

    • Validate positive hits using orthogonal methods

  • Proximity Labeling Methods:

    • BioID or APEX2 fusions to identify proteins in close proximity to ST7 in living cells

    • Provides context-dependent interaction data

  • Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC):

    • Quantitative measurement of binding affinities between ST7 and validated partners

    • Determine thermodynamic parameters of interactions

  • Mammalian Two-Hybrid Assays:

    • Verify interactions in mammalian cellular context

    • Useful for confirming Y2H results in a more physiologically relevant system

These methodologies provide complementary data that together build a comprehensive understanding of ST7's interactome in normal and disease states.

How can researchers distinguish between isoforms and post-translational modifications of ST7?

Distinguishing between ST7 isoforms and identifying post-translational modifications requires a strategic analytical approach:

  • Mass Spectrometry Analysis:

    • High-resolution LC-MS/MS for precise molecular weight determination

    • Post-translational modification mapping using targeted approaches

    • Comparison with predicted weights from the amino acid sequence (65.6 kDa for full-length Microcebus murinus ST7)

  • Western Blotting with Isoform-Specific Antibodies:

    • Develop antibodies targeting unique regions of different isoforms

    • Use mobility shift assays to detect modifications (similar to those observed with murine Sbsn-2)

  • 2D Gel Electrophoresis:

    • Separate proteins by both isoelectric point and molecular weight

    • Effective for distinguishing modified forms with similar molecular weights

  • Phospho-specific or Modification-specific Antibodies:

    • Use commercially available antibodies targeting common modifications

    • Develop custom antibodies for ST7-specific modifications

Research has shown that related proteins can undergo various post-translational modifications such as citrullination (observed in Sbsn in a Parkinson's disease model) and glycosylation (predicted for SBSN-1) . Similar modifications may occur in ST7 and affect its function or stability.

How can structural biology approaches enhance understanding of ST7 function?

Advanced structural biology techniques offer powerful insights into ST7 function through detailed molecular characterization:

  • X-ray Crystallography:

    • Determine high-resolution 3D structure of ST7

    • Co-crystallization with binding partners to elucidate interaction interfaces

    • Structure-based drug design targeting ST7 pathways

  • Cryo-Electron Microscopy (Cryo-EM):

    • Visualize larger ST7-containing complexes

    • Capture dynamic conformational states

  • Nuclear Magnetic Resonance (NMR):

    • Analyze solution dynamics of smaller ST7 domains

    • Study weak or transient interactions difficult to capture by other methods

  • Computational Structure Prediction:

    • Generate models using templates with similar fold characteristics

    • Potential templates include Pseudomonas sp. mis38 lipase (PDB: 2ZJ6) or methyl-accepting chemotaxis proteins, which have been used for similar structural predictions

  • Molecular Dynamics Simulations:

    • Investigate conformational flexibility

    • Predict effects of mutations on protein stability and function

These approaches can generate hypotheses about functional mechanisms that can then be tested experimentally through mutational analysis and functional assays.

What are the comparative differences in tumor suppressor function between Microcebus murinus ST7 and homologs in other species?

Comparing Microcebus murinus ST7 with homologs from other species reveals important evolutionary insights into tumor suppression mechanisms:

  • Primate Evolution Patterns:

    • Several primates, including Microcebus murinus, Macaca mulatta, and Pan paniscus, lack certain isoforms present in humans

    • These differences may reflect evolutionary adaptations in tumor suppression mechanisms

  • Rodent Comparisons:

    • Multiple rodents lack homologs corresponding to certain human isoforms

    • Splicing differences between mouse and human may affect protein function

  • Functional Conservation Assessment:

    • Critical functional domains show higher conservation across species

    • Species-specific variations may correlate with differences in cancer susceptibility

  • Experimental Approach for Comparison:

    • Express ST7 homologs from different species in common cellular backgrounds

    • Perform rescue experiments in ST7-deficient cell lines

    • Compare effects on proliferation, migration, and apoptosis

This comparative approach helps identify the core conserved functions of ST7 while highlighting species-specific adaptations, potentially informing both evolutionary biology and cancer research.

What in vivo models are suitable for studying ST7 function in tumor suppression?

Selecting appropriate in vivo models for ST7 research requires careful consideration of biological relevance and experimental tractability:

  • Mouse Models:

    • Conditional knockout of ST7 in specific tissues

    • Xenograft models using cells with manipulated ST7 expression

    • CRISPR-engineered point mutations mimicking human disease variants

  • Microcebus murinus (Mouse Lemur) Models:

    • Direct studies in the native species

    • Particularly valuable for evolutionary comparisons

    • Limited by practical challenges of working with non-model primates

  • Zebrafish Models:

    • Rapid development and optical transparency

    • CRISPR-mediated knockout or knockdown approaches

    • Useful for high-throughput screening of ST7 variants

  • Cell Line Xenografts:

    • Implantation of human or Microcebus murinus cells with altered ST7 expression

    • Useful for studying tumor growth, invasion, and metastasis

  • Organoid Models:

    • 3D cultures that better recapitulate tissue architecture

    • Can be derived from multiple species for comparative studies

    • Useful for studying ST7's role in tissue organization

Each model system offers distinct advantages, and complementary use of multiple models can provide more robust and translatable findings about ST7 function in tumor suppression.

How does ST7 expression correlate with prognosis in cancer studies?

While specific correlational studies for Microcebus murinus ST7 are not extensively documented, insights can be drawn from related tumor suppressor research:

  • Expression Analysis in Clinical Samples:

    • Similar to other tumor suppressors, reduced ST7 expression would likely correlate with poorer outcomes

    • Example: miR-7 expression is attenuated in T-cell acute lymphoblastic leukemia cells compared to healthy controls

  • Prognostic Biomarker Potential:

    • ST7 expression levels could serve as potential prognostic indicators

    • Similar to how miR-7 has been suggested as a prognostic biomarker in T-ALL

  • Correlation with Other Molecular Markers:

    • Integrated analysis with other established biomarkers may improve prognostic accuracy

    • Understanding how ST7 fits into broader molecular signatures of cancer progression

  • Therapeutic Response Prediction:

    • ST7 status might predict response to specific therapeutic approaches

    • Similar to how miR-7 regulates sensitivity to chemotherapeutic agents in various tumor types

Research on related tumor suppressors suggests that ST7 could serve as a valuable prognostic indicator and potential therapeutic target in various cancers.

What are common challenges in expressing and purifying functional Recombinant Microcebus murinus ST7?

Researchers commonly encounter several challenges when working with Recombinant Microcebus murinus ST7:

  • Protein Solubility Issues:

    • ST7 contains hydrophobic domains that may lead to aggregation

    • Solution: Optimize expression temperature (often lower temperatures improve solubility) and include solubilizing agents like mild detergents

  • Proper Folding:

    • Complex protein structure may not fold correctly in bacterial systems

    • Solution: Consider co-expression with chaperones or use slower induction protocols

  • Yield Optimization:

    • Expression levels may be lower than expected

    • Solution: Optimize codon usage, evaluate different promoter systems, and test multiple E. coli strains

  • Purification Specificity:

    • Non-specific binding to affinity resins

    • Solution: Include low concentrations of imidazole in binding buffers and optimize wash conditions

  • Protein Stability:

    • Protein degradation during purification or storage

    • Solution: Include protease inhibitors during purification and store with recommended 50% glycerol at -80°C

Addressing these challenges requires systematic optimization of expression and purification protocols tailored to the specific biochemical properties of ST7.

How can researchers validate the tumor suppressor activity of Recombinant Microcebus murinus ST7?

Validating the tumor suppressor activity of Recombinant Microcebus murinus ST7 requires a multi-faceted experimental approach:

  • Cell Proliferation Assays:

    • MTT/3-(4,5-dimethylthiazol-2-Yl)-2,5-diphenyltetrazolium bromide assays to measure growth inhibition

    • Similar to approaches used for miR-7 in T-ALL cells

    • BrdU incorporation to measure DNA synthesis

  • Colony Formation Assays:

    • Soft agar assays to assess anchorage-independent growth

    • These assays effectively demonstrated reduced growth in miR-7-transfected cells

  • Apoptosis Assessment:

    • Annexin V staining to detect early apoptotic cells

    • TUNEL assays to identify DNA fragmentation

    • Measurement of apoptotic markers (caspase-3, Bcl-2)

  • Migration and Invasion Studies:

    • Transwell assays to evaluate cell motility

    • Wound healing assays to assess migration capacity

  • Target Gene Regulation:

    • qRT-PCR and Western blot analysis to identify downstream effectors

    • Comparison with known tumor suppressor pathways

  • In vivo Tumor Models:

    • Xenograft studies with cells overexpressing ST7

    • Measurement of tumor growth, invasion, and metastasis

These complementary approaches provide robust validation of tumor suppressor activity in various experimental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.