Recombinant Microcebus tavaratra Cytochrome c oxidase subunit 2 (MT-CO2)

What is Microcebus tavaratra MT-CO2 and how does it differ from other cytochrome c oxidase subunits?

Microcebus tavaratra MT-CO2 is the second subunit of cytochrome c oxidase derived from the Northern rufous mouse lemur (Microcebus tavaratra). This protein is encoded by the MT-CO2 gene located on mitochondrial DNA and constitutes one of the three mitochondrially encoded subunits of respiratory complex IV . The full-length protein contains 227 amino acids and functions as part of the catalytic core of cytochrome c oxidase, which serves as the terminal electron acceptor in the mitochondrial respiratory chain .

Unlike subunit I (which contains heme a and heme a3-CuB centers), MT-CO2 houses the binuclear copper A (CuA) center that is crucial for accepting electrons from cytochrome c . The CuA center is located within a conserved cysteine loop at positions 196 and 200, with an additional conserved histidine at position 204 . This structural arrangement makes MT-CO2 particularly important for the initial electron transfer steps in the oxidative phosphorylation process.

What is the structural composition of recombinant MT-CO2 protein and how is it typically prepared?

Recombinant Microcebus tavaratra MT-CO2 protein is typically prepared as a full-length (amino acids 1-227) protein with an N-terminal His-tag to facilitate purification . The complete amino acid sequence is:

MAHPAQLGFQDAASPIMEELMYFHDHTLMIVFLISSLVLYIISLMLTTELTHTSTMDAQEVETVWTILPAVILILIALPSLRILYMMDEITTPSLTLKTMGHQWYWSYEYTDYESLCFDSYMTPPLELDPGELRLLEVDNRVVLPTEMSIRMLISSEDVLHSWTVPSLGVKTDAIPGRLNQATLMTSRPGIYYGQCSEICGANHSFMPIVLELVPLKHFEEWLLSTL

The N-terminal domain contains two transmembrane alpha-helices that anchor the protein within the mitochondrial inner membrane . For research applications, the protein is commonly expressed in E. coli expression systems and purified to greater than 90% purity as determined by SDS-PAGE . The recombinant protein is typically supplied as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What functional roles does MT-CO2 play in the electron transport chain?

MT-CO2 plays a critical role in the electron transport chain as part of cytochrome c oxidase (Complex IV). This complex catalyzes the transfer of electrons from reduced cytochrome c to molecular oxygen, ultimately forming water . The electron transfer pathway involves:

• Acceptance of electrons from the mobile carrier cytochrome c at the CuA center located in MT-CO2

• Transfer of electrons through the protein to the heme a and heme a3-CuB centers in subunit I

• Reduction of molecular oxygen to water at the binuclear center

This process constitutes the final step in the electron transport chain and is coupled to proton pumping across the mitochondrial inner membrane, contributing to the proton gradient that drives ATP synthesis . MT-CO2's specific role in this process focuses on the initial electron acceptance from cytochrome c, making it a crucial interface between the mobile electron carrier and the catalytic machinery of complex IV .

What are the optimal storage and handling conditions for recombinant MT-CO2 protein?

For optimal stability and activity of recombinant MT-CO2 protein, researchers should follow these handling protocols:

• Storage conditions: Store the lyophilized protein at -20°C to -80°C upon receipt

• Reconstitution protocol: Briefly centrifuge the vial before opening to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Long-term storage: Add glycerol to a final concentration of 5-50% (50% is recommended) and aliquot for long-term storage at -20°C to -80°C

• Freeze-thaw cycles: Avoid repeated freeze-thaw cycles as they can compromise protein integrity

• Working aliquots: Store working aliquots at 4°C for up to one week to minimize degradation

These conditions are designed to maintain the structural integrity of the CuA center and prevent protein aggregation or denaturation that could affect experimental outcomes.

What crosslinking methodologies are effective for studying MT-CO2 interactions with cytochrome c?

Studying the interaction between MT-CO2 and cytochrome c can be achieved using water-soluble carbodiimide crosslinking methods . The protocol typically involves:

• Preparation of purified MT-CO2 and cytochrome c proteins

• Incubation of the proteins together with a water-soluble carbodiimide such as 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC)

• Optimization of reaction conditions: pH, temperature, protein concentrations, and carbodiimide concentration

• Analysis of crosslinked products using SDS-PAGE, Western blotting, or mass spectrometry

This approach allows for identification of specific binding sites and interaction points between cytochrome c and MT-CO2 . Research has demonstrated that cytochrome c specifically crosslinks to subunit II of cytochrome c oxidase, confirming direct protein-protein interaction at the CuA center region . Alternative approaches include fluorescent labeling with reagents like fluorescein mercuric acetate which can partially inactivate the enzyme while allowing for visualization of binding sites .

How can researchers verify the functional activity of recombinant MT-CO2 in reconstituted systems?

Verification of recombinant MT-CO2 functional activity requires assessment of its electron transfer capabilities within reconstituted systems. Methodological approaches include:

• Cytochrome c oxidation assay: Measure the rate of cytochrome c oxidation spectrophotometrically at 550 nm, which reflects electron transfer from reduced cytochrome c to the CuA center in MT-CO2

• Oxygen consumption measurements: Monitor oxygen consumption using oxygen electrodes when MT-CO2 is incorporated into proteoliposomes or membrane fractions containing the complete cytochrome c oxidase complex

• Reconstitution experiments:

  • Incorporate purified recombinant MT-CO2 into liposomes or nanodiscs

  • Add other cytochrome c oxidase subunits to form functional complexes

  • Assess electron transfer activity with cytochrome c as an electron donor

• Spectroscopic analysis: Examine the spectral properties of the CuA center using electron paramagnetic resonance (EPR) or UV-visible spectroscopy to confirm proper incorporation of copper ions and structural integrity

These functional assays provide critical information about whether the recombinant MT-CO2 can participate in electron transfer reactions similar to the native protein.

How does Microcebus tavaratra MT-CO2 compare structurally and functionally to human MT-CO2?

Comparative analysis between Microcebus tavaratra MT-CO2 and human MT-CO2 reveals important similarities and differences:

Structural Comparisons:

Functional Comparisons:

• Both proteins serve as the primary electron acceptors from cytochrome c in the respiratory chain

• The fundamental electron transfer mechanism through the CuA center appears conserved between species

• Species-specific differences in electron transfer kinetics or protein-protein interaction surfaces may exist but would require detailed biochemical characterization

A systematic study comparing electron transfer rates, binding affinities for cytochrome c, and response to inhibitors between the two species' proteins would provide valuable insights into evolutionary conservation of this critical respiratory component.

What can comparative studies between MT-CO2 from different lemur species reveal about evolutionary adaptations?

Comparative analysis of MT-CO2 from different lemur species, including Microcebus tavaratra (Northern rufous mouse lemur), can provide significant insights into evolutionary adaptations:

• Mitochondrial evolution: As MT-CO2 is encoded by mitochondrial DNA, sequence variations across lemur species can reflect maternal lineage evolutionary patterns and rates of mitochondrial genome evolution

• Metabolic adaptations: Variations in MT-CO2 structure might correlate with metabolic adaptations to different ecological niches, dietary patterns, or activity levels among lemur species

• Functional constraints: Highly conserved regions likely represent functional domains critical for electron transfer, while variable regions may indicate adaptations to species-specific respiratory demands

• Protein-protein interaction surfaces: Differences in the regions that interact with cytochrome c or other subunits could reveal co-evolutionary patterns between interacting partners

Research approaches would include:

• Phylogenetic analysis of MT-CO2 sequences across lemur species

• Structure-function correlation studies examining adaptive mutations

• Biochemical characterization of electron transfer kinetics in different species

• Reconstitution experiments with hybrid systems containing components from different species

These comparative studies could enhance our understanding of mitochondrial adaptations in primate evolution and potentially identify mutations that optimize respiratory function in different ecological contexts.

How can site-directed mutagenesis of recombinant MT-CO2 provide insights into CuA center function?

Site-directed mutagenesis of recombinant MT-CO2 offers a powerful approach to investigate the structure-function relationships of the CuA center. This methodology can address several critical questions:

• Copper coordination: Mutations of the conserved cysteine residues at positions 196 and 200, as well as the conserved histidine at position 204, can reveal the precise contribution of each residue to copper coordination and electron transfer capabilities

• Electron transfer pathways: Strategic mutations along the predicted electron transfer pathway from the CuA center to other redox centers can help map the electron flow through the protein

• Protein-protein interaction: Mutations at the cytochrome c binding interface can identify key residues for recognition and optimal electron transfer

Experimental design should include:

• Generation of point mutations using PCR-based techniques

• Expression and purification of mutant proteins

• Spectroscopic characterization of the CuA center in mutants

• Functional assays measuring electron transfer rates

• Structural analysis via X-ray crystallography or cryo-EM

• Protein-protein interaction studies with cytochrome c

The correlation between structural changes and functional outcomes can provide detailed mechanistic insights into how the CuA center operates and how minor alterations affect the electron transfer process in the respiratory chain.

What approaches are effective for studying assembly of MT-CO2 into functional cytochrome c oxidase complexes?

Studying the assembly of MT-CO2 into functional cytochrome c oxidase complexes requires multifaceted approaches spanning from genetic to biochemical techniques:

• Reconstitution systems:

  • In vitro reconstitution of purified subunits, including recombinant MT-CO2, in the presence of lipids and assembly factors

  • Monitoring complex formation using blue native PAGE or sucrose gradient centrifugation

  • Assessment of assembled complex activity through functional assays

• Assembly factor studies:

  • Identification and characterization of proteins that facilitate MT-CO2 incorporation into the complex

  • Analysis of the temporal sequence of assembly events and intermediate complexes

  • Investigation of specific chaperones that may assist in copper incorporation into the CuA center

• Time-resolved analysis:

  • Pulse-chase experiments to track the kinetics of MT-CO2 incorporation

  • Use of inducible expression systems to trigger synchronized assembly

  • Cryo-EM analysis of assembly intermediates at different time points

• Membrane integration studies:

  • Analysis of how the transmembrane helices of MT-CO2 are inserted into the mitochondrial inner membrane

  • Investigation of lipid-protein interactions that stabilize MT-CO2 within the complex

  • Examination of how the N-terminal domain positioning affects subsequent assembly steps

These approaches collectively provide insights into the coordinated process of cytochrome c oxidase assembly, which requires both mitochondrially-encoded subunits like MT-CO2 and nuclear-encoded components to form a functional enzyme complex .

What are the methodological challenges in characterizing the interaction between MT-CO2 and cytochrome c in different redox states?

Characterizing the interaction between MT-CO2 and cytochrome c in different redox states presents several methodological challenges that require sophisticated experimental approaches:

• Maintaining defined redox states:

  • Challenge: Spontaneous oxidation/reduction during experiments

  • Solution: Conduct experiments in anaerobic chambers with precise control of reducing/oxidizing agents

  • Approach: Use of redox poising systems with appropriate mediators to maintain specific potentials

• Capturing transient interactions:

  • Challenge: The electron transfer interaction may be fast and transient

  • Solution: Use of ultra-fast spectroscopic techniques or rapid freeze-quench methods

  • Approach: Time-resolved spectroscopy to capture intermediate states during electron transfer

• Structural dynamics during electron transfer:

  • Challenge: Conformational changes accompanying electron transfer are difficult to capture

  • Solution: Combine functional studies with structural methods sensitive to dynamic changes

  • Approach: Hydrogen-deuterium exchange mass spectrometry, single-molecule FRET, or EPR spectroscopy with site-directed spin labeling

• Distinguishing direct vs. allosteric effects:

  • Challenge: Determining whether observed effects are due to direct interaction or allosteric changes

  • Solution: Combine site-directed mutagenesis with functional studies

  • Approach: Engineer variants with altered interaction surfaces but preserved electron transfer capability

• Reconstitution of physiological environment:

  • Challenge: In vitro systems may not recapitulate the native membrane environment

  • Solution: Develop membrane mimetic systems that better represent the mitochondrial inner membrane

  • Approach: Use of nanodiscs, liposomes with defined lipid composition, or supported bilayers

Research has shown that the interaction between cytochrome c and COX II involves specific binding sites that can be identified through crosslinking studies . Differential behavior in oxidized versus reduced states has been observed, suggesting redox-dependent conformational changes that affect binding affinity and electron transfer kinetics .

How can studies with recombinant MT-CO2 contribute to understanding mitochondrial diseases?

Recombinant MT-CO2 research offers valuable insights into mitochondrial diseases through several research approaches:

• Modeling disease-causing mutations:

  • Introducing mutations identified in human patients into recombinant MT-CO2

  • Characterizing the biochemical consequences on protein stability, copper binding, and electron transfer

  • Correlating biochemical defects with clinical phenotypes

• Functional rescue experiments:

  • Testing whether wild-type recombinant MT-CO2 can complement defective MT-CO2 in disease models

  • Developing gene therapy or protein replacement strategies

  • Screening for small molecules that stabilize mutant MT-CO2 or enhance residual activity

• Biomarker development:

  • Identifying specific functional or structural alterations in MT-CO2 that could serve as diagnostic markers

  • Developing antibodies or activity assays to detect abnormal MT-CO2 in patient samples

  • Correlating MT-CO2 dysfunction with clinical progression

• Comparative species studies:

  • Using Microcebus tavaratra MT-CO2 as a model to understand how subtle sequence variations affect function

  • Investigating whether certain species harbor natural resistance to mutations that cause disease in humans

  • Identifying compensatory mechanisms that might be therapeutically relevant

Research has documented that missense mutations in the MT-CO2 gene can cause disease, as observed in a 14-year-old boy with a mitochondrial disorder . Understanding the molecular basis of such mutations through recombinant protein studies provides crucial insights into pathogenesis and potential therapeutic approaches.

What protocols are recommended for analyzing MT-CO2 copper incorporation and its disruption in experimental models?

Analysis of copper incorporation into the CuA center of MT-CO2 and its potential disruption requires specialized protocols:

• Spectroscopic analysis of copper binding:

  • UV-visible spectroscopy to monitor characteristic absorbance of CuA center

  • Electron paramagnetic resonance (EPR) spectroscopy to characterize the copper coordination environment

  • X-ray absorption spectroscopy for detailed analysis of copper oxidation state and ligand geometry

• Copper incorporation assays:

  • In vitro reconstitution of apo-MT-CO2 with copper ions under various conditions

  • Use of isotopically labeled copper (63Cu, 65Cu) for tracking experiments

  • Competition assays with other metal ions to assess specificity

• Cellular copper delivery systems:

  • Investigation of copper chaperones that might deliver copper to MT-CO2

  • Analysis of how mitochondrial copper import affects MT-CO2 maturation

  • Examination of cellular copper homeostasis in relation to MT-CO2 assembly

• Disruption models:

  • Copper chelation experiments to remove copper from the CuA center

  • Introduction of competing metal ions (zinc, silver) to displace copper

  • Mutation of copper-coordinating residues to prevent proper incorporation

• Quantitative analysis:

  • Inductively coupled plasma mass spectrometry (ICP-MS) for precise quantification of copper content

  • Ratio analysis of copper to protein to determine occupancy of binding sites

  • Correlation between copper content and electron transfer activity

These methodologies can reveal how copper incorporation into MT-CO2 is regulated and potentially disrupted in disease states, providing insights into both fundamental bioinorganic chemistry and pathological mechanisms.

How might recombinant MT-CO2 be utilized in evolutionary studies of primate respiratory adaptations?

Recombinant MT-CO2 from Microcebus tavaratra offers unique opportunities for evolutionary studies of primate respiratory adaptations:

• Comparative biochemistry across primate lineages:

  • Production of recombinant MT-CO2 from various primate species

  • Systematic comparison of electron transfer kinetics, thermal stability, and interaction with cytochrome c

  • Correlation of biochemical properties with ecological niches and metabolic demands

• Ancestral sequence reconstruction:

  • Computational inference of ancestral MT-CO2 sequences at key nodes in primate evolution

  • Expression and characterization of these ancestral proteins

  • Direct measurement of how MT-CO2 function has evolved over millions of years

• Molecular adaptation analysis:

  • Identification of sites under positive selection in different primate lineages

  • Functional characterization of these adaptively evolved residues

  • Understanding how environmental pressures shaped respiratory efficiency

• Hybrid systems analysis:

  • Creation of chimeric proteins combining domains from different primate species

  • Testing compatibility between MT-CO2 and other cytochrome c oxidase subunits across species

  • Identifying co-evolutionary constraints between interacting subunits

• Climate adaptation studies:

  • Examining MT-CO2 variations in primates from different thermal environments

  • Analyzing temperature dependence of electron transfer in different species' enzymes

  • Understanding adaptations to hypoxic environments (high altitude, burrowing behavior)

This research direction could reveal how mitochondrial proteins have adapted to diverse ecological pressures throughout primate evolution and potentially identify molecular mechanisms underlying metabolic differences between primates, including humans.

What emerging technologies might enhance structural and functional characterization of MT-CO2?

Several emerging technologies hold promise for advancing our understanding of MT-CO2 structure and function:

• Cryo-electron microscopy (Cryo-EM):

  • High-resolution structural determination of MT-CO2 within the intact cytochrome c oxidase complex

  • Visualization of conformational changes during the catalytic cycle

  • Structural analysis of disease-causing mutations

• Single-molecule techniques:

  • FRET-based approaches to monitor conformational dynamics during electron transfer

  • Optical tweezers to study protein-protein interaction forces

  • Single-molecule electrophysiology to measure electron transfer at the individual protein level

• Time-resolved structural methods:

  • Time-resolved X-ray crystallography using X-ray free electron lasers

  • Time-resolved cryo-EM to capture intermediate states during electron transfer

  • Ultrafast spectroscopy to follow electron movement through the protein

• Computational advances:

  • Quantum mechanical/molecular mechanical (QM/MM) simulations of electron transfer

  • Machine learning approaches to predict mutation effects on function

  • Molecular dynamics simulations of MT-CO2 in membrane environments

• Synthetic biology approaches:

  • Creation of minimal cytochrome c oxidase systems with engineered properties

  • In vivo directed evolution to optimize MT-CO2 function

  • Development of semi-synthetic protein systems incorporating non-canonical amino acids

These technologies would allow researchers to address fundamental questions about the mechanism of electron transfer through MT-CO2, the dynamics of protein-protein interactions, and the precise structural arrangements that enable efficient respiratory function.