Recombinant Micrococcus luteus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
atpF; Mlut_08140; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) (Micrococcus lysodeikticus)
Target Names
atpF
Target Protein Sequence
MISNGLILAAAEGANPLIPNPWEILVVVVGFALLMFIVIKFIVPTLEKSYQDRVEAIEGG LAKAEKAQAEANAMMADYESQLADARTEANRIREDARTEAAEIVAEARERATAEATRVFE QAQAQIAAERQQAAAQLKREVGSLATTLAGKIVGESLEDDARSQRVVDRFLADLDRHQSA GVAE
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the complete amino acid sequence of Micrococcus luteus ATP synthase subunit b (atpF)?

The complete 184-amino acid sequence of Micrococcus luteus ATP synthase subunit b is:
MISNGLILAAAEGANPLIPNPWEILVVVVGFALLMFIVIKFIVPTLEKSYQDRVEAIEGGLAKAEKAQAEANAMMADYESQLADARTEANRIREDARTEAAEIVAEARERATAEATRVFEQAQAQIAAERQQAAAQLKREVGSLATTLAGKIVGESLEDDARSQRVVDRFLADLDRHQSAGVAE

What is the functional role of ATP synthase subunit b in bacterial energy metabolism?

ATP synthase subunit b functions as a critical component of the F0 sector, serving as a peripheral stalk that connects the membrane-embedded F0 sector to the catalytic F1 sector. This connection maintains structural integrity during the rotational catalysis process. In M. luteus, as in other bacteria, this subunit helps stabilize the enzyme complex during ATP synthesis and hydrolysis, maintaining efficiency across varying environmental conditions, particularly during temperature fluctuations that affect activation energy requirements.

How does the nomenclature and classification of ATP synthase subunits in M. luteus compare with other bacterial species?

Sequence analysis reveals interesting evolutionary relationships between ATP synthase subunits across bacterial species. For example, while the delta-subunit of M. luteus ATP synthase lacks homology with other known ATP synthase delta-subunits, it shows significant structural and sequence equivalence to the epsilon-subunit of E. coli. Additionally, the epsilon-subunit from M. luteus demonstrates homology to regions in delta-subunits and Oligomycin Sensitivity Conferring Protein (OSCP) from other organisms, suggesting evolutionary divergence in nomenclature despite functional conservation.

How does temperature affect the kinetics of M. luteus ATP synthase activity?

Temperature significantly impacts M. luteus ATP synthase activity, with distinct transitions in enzyme behavior. Experimental data shows a clear discontinuity in the Arrhenius plot at 32 ± 0.5°C for the delta-subunit associated enzyme. Below this critical temperature threshold, the activation energy (Ea) is remarkably high at 231.5 ± 5 kJ mol-1, while above this temperature the Ea decreases dramatically to 76.4 ± 3 kJ mol-1. This temperature-dependent behavior indicates a conformational change in the enzyme complex that alters its catalytic efficiency.

What buffer conditions optimize the stability and activity of recombinant M. luteus atpF?

Based on experimental protocols, M. luteus ATP synthase components, including the b subunit, demonstrate optimal stability in Tris-based buffers with 50% glycerol for storage. For functional studies, Tris-HCl buffer (pH 8.0) is frequently used, though extended incubation (70+ minutes) in this buffer can affect activity rates through subunit dissociation. For research applications requiring longer-term storage, maintaining the protein at -20°C or -80°C is recommended, with working aliquots kept at 4°C for up to one week to minimize freeze-thaw cycles that could compromise structural integrity.

What factors influence the assembly of bacterial F-type ATP synthases and how can this knowledge be applied to M. luteus studies?

ATP and Mg2+ are crucial cofactors for the proper assembly of bacterial F-type ATP synthases. Experimental evidence from both LILBID (Laser-Induced Liquid Bead Ion Desorption) and SEC (Size Exclusion Chromatography) confirms that these additives are essential for the in vitro assembly of subunits α and β of Na+-F1FO-ATP synthases. When designing reconstitution experiments with M. luteus ATP synthase components, including atpF, these cofactors should be incorporated to ensure proper complex formation and functional activity.

How can researchers effectively design experiments to study subunit interactions within the M. luteus ATP synthase complex?

To investigate subunit interactions within the M. luteus ATP synthase complex:

  • Reconstitution experiments: Co-reconstitute purified recombinant atpF with other ATP synthase subunits in the presence of ATP/Mg2+ to assess assembly dynamics.

  • Functional coupling assays: For studying the interaction between atpF and other subunits, designs similar to those used with bacteriorhodopsin can be implemented, where ATP synthesis and hydrolysis can be monitored upon illumination with specific wavelengths (505-575 nm).

  • Dissociation kinetics: Monitor lag phases in activity (approximately 50s in coupled systems) as indicators of inhibitor protein dissociation, with activity measurements dependent on ATP-synthase concentration.

What approaches can be used to investigate the role of ATP synthase in bacterial biofilm formation?

To investigate ATP synthase's role in biofilm formation, researchers can:

  • Generate targeted mutations: Create transposon or deletion mutants in ATP synthase subunits (as demonstrated with atpA in S. aureus) to assess effects on biofilm architecture and immune response.

  • Microscopy analysis: Employ confocal laser scanning microscopy to analyze biofilm structure and leukocyte infiltration patterns.

  • Cytokine profiling: Measure proinflammatory cytokine production (IL-12p70, TNF-α, IL-6) in response to wild-type versus ATP synthase-mutant biofilms.

  • Proteomic analysis: Use LC-MS/MS to identify differences in toxin and protease production between wild-type and ATP synthase mutant strains.

How does the subunit composition of ATP synthase affect its enzymatic activity in M. luteus?

Subunit composition significantly impacts ATP synthase activity in M. luteus. The reversible dissociation of the delta-subunit can increase ATP hydrolysis rates approximately three-fold after 70 minutes of incubation in Tris-HCl (pH 8.0). This demonstrates that subunit dynamics directly influence catalytic efficiency. For accurate activity measurements, researchers should account for the temporal dimension of subunit association states and potentially stabilize specific conformations when consistent enzymatic parameters are required.

What protein expression and purification strategies are most effective for recombinant M. luteus atpF?

For optimal expression and purification of recombinant M. luteus atpF:

  • Expression system selection: While the search results don't specify the optimal expression system, the full-length protein (region 1-184) has been successfully expressed recombinantly.

  • Purification approach: Tag-based purification is commonly employed, though the specific tag type may vary based on experimental requirements and determined during the production process.

  • Storage considerations: For maximum stability, store the purified protein in Tris-based buffer with 50% glycerol at -20°C for regular use or -80°C for extended storage.

  • Handling precautions: Avoid repeated freeze-thaw cycles as they may compromise protein integrity; instead, prepare working aliquots stored at 4°C for up to one week.

What analytical techniques can be used to study the structure-function relationship of M. luteus atpF?

To investigate structure-function relationships of M. luteus atpF, researchers can employ:

  • Automated Edman degradation: This technique has been successfully used to identify N-terminal protein sequences of ATP synthase subunits in M. luteus.

  • Secondary structure calculations: Combined with amino acid sequence alignment, these provide insights into structural homology with subunits from other organisms.

  • Reconstitution systems: Co-reconstitution with components like monomeric bacteriorhodopsin creates functional systems for measuring activity under controlled conditions.

  • Temperature-dependent kinetic studies: These reveal conformational transitions that affect catalytic efficiency (as seen in the discontinuity in Arrhenius plots at specific temperatures).

What are the key challenges in interpreting ATP synthase activity data across different experimental conditions?

Interpreting ATP synthase activity data presents several challenges:

  • Subunit dissociation effects: The reversible dissociation of subunits (like the delta-subunit) can cause apparent increases in activity over time, complicating kinetic measurements.

  • Temperature-dependent behavior: The dramatic shift in activation energy at specific temperatures (32 ± 0.5°C for M. luteus) necessitates careful temperature control during experiments.

  • Coupling efficiency variations: When studying reconstituted systems (like ATP-synthase with bacteriorhodopsin), lag periods of approximately 50 seconds must be accounted for in activity measurements.

  • Concentration dependencies: Activity variations correlate with ATP-synthase concentration, requiring standardization when comparing across experimental conditions.

How might knowledge of ATP synthase structure and function contribute to addressing antimicrobial resistance?

ATP synthase research may contribute to combating antimicrobial resistance through:

  • Novel target identification: ATP synthase is essential for bacterial energy metabolism, and specific subunits may represent targets for antimicrobial development.

  • Biofilm disruption strategies: Given the role of ATP synthase in biofilm persistence (demonstrated in S. aureus), targeting this complex might enhance biofilm clearance by promoting immune infiltration and proinflammatory responses.

  • Comparative structure analysis: The unique structural features of bacterial ATP synthases compared to human counterparts could enable selective targeting.

  • Immune response modulation: Understanding how ATP synthase influences host immune responses to bacterial infections may reveal immunomodulatory approaches to enhance bacterial clearance.

What is the relationship between ATP synthase function and the essential secreted growth factors in M. luteus?

M. luteus produces an essential secreted growth factor called Rpf (resuscitation-promoting factor), which is required for growth and resuscitation of dormant cells. While the direct relationship between ATP synthase and Rpf is not explicitly established in the literature, both are critical for M. luteus viability. ATP synthase provides the energy currency (ATP) necessary for cellular processes, while Rpf functions as an autocrine and paracrine signaling molecule essential for growth initiation. Understanding the potential metabolic connections between energy production via ATP synthase and growth signaling via Rpf could provide insights into bacterial dormancy and resuscitation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.