Recombinant Microcystis aeruginosa Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
petA; MAE_19230; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-328
Protein Length
Full Length of Mature Protein
Species
Microcystis aeruginosa (strain NIES-843)
Target Names
petA
Target Protein Sequence
YPFWAQQTAPETPREATGRIVCANCHLAQKPAEIEIPHSVLPDSVFEAVVKIPYDPASQQ VLGDGSKGGLNVGAVLMLPDGFKIAPPDRIPEEMQEKLGGVYFQSYKEGQDNVVIVGPLP GDQYKEIVFPVLAPDPSQNKGIHFGKYAVHLGANRGRGQVYPTGEPSNNNAFKASTAGTI SQISKTEAGGYEVTITSEAGPVVENIPAGPELIVSEGQAIEVGQFLTSNPNVGGFGQKDT EVVLQNPGRIKGLVLFLGGIMLCQILLVIKKKQVETVQAAEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome f family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its role in Microcystis aeruginosa?

Apocytochrome f is the precursor form of cytochrome f, encoded by the petA gene (MAE_19230 in M. aeruginosa strain NIES-843), before heme attachment . In M. aeruginosa, cytochrome f functions as an essential component of the cytochrome b6f complex located in the thylakoid membrane, serving as a crucial intermediary in the photosynthetic electron transport chain. This protein facilitates electron transfer between photosystem II and photosystem I, making it vital for energy production in this cyanobacterium .

The mature form contains a heme group covalently attached via thioether bonds to cysteine residues, with the functional protein anchored to the thylakoid membrane. In M. aeruginosa, proper functioning of the photosynthetic apparatus, including cytochrome f, is particularly important as this organism forms harmful algal blooms in freshwater ecosystems, with its ecological dominance heavily dependent on efficient photosynthesis .

How does petA expression relate to microcystin production in Microcystis aeruginosa?

Research comparing toxic and non-toxic strains of M. aeruginosa has revealed important relationships between photosynthesis-related genes (including petA) and toxin production:

ConditionpetA ExpressionMicrocystin ProductionPhotosynthetic Efficiency
Non-toxic strain (MC-)BaselineNoneNormal
Toxic strain (MC+)Slightly reducedHighSlightly reduced
Stressed MC+ strainSignificantly alteredVariableCompromised
Co-culture conditionsStrain-dependentModifiedContext-dependent

Studies show that microcystin may play a regulatory role in photosynthesis, with an inverse relationship sometimes observed between microcystin content and photosynthetic protein expression . When toxic and non-toxic strains were co-cultured, photosynthesis-related gene expression patterns (including those encoding electron transport proteins) showed distinct changes . Notably, microcystin presence appears to inhibit certain allergenic proteins in M. aeruginosa, suggesting complex regulatory mechanisms that may extend to photosynthetic apparatus components .

What expression systems are most effective for producing functional Recombinant M. aeruginosa Apocytochrome f?

When selecting an expression system for Recombinant M. aeruginosa Apocytochrome f, researchers should consider:

Prokaryotic Systems:

  • E. coli BL21(DE3): Commonly used for initial attempts due to rapid growth and high yields

  • Specialized E. coli strains: For example, Rosetta™ or OrigamiB™ strains that accommodate rare codons or enhance disulfide bond formation

  • Cyanobacterial hosts: Synechocystis sp. PCC 6803 offers proper folding environment but lower yields

Expression Strategy Comparison:

Expression SystemAdvantagesDisadvantagesPurification Tag Recommendation
E. coli (cytoplasmic)High yield, rapid growthImproper folding, inclusion bodiesN-terminal His6 with TEV cleavage site
E. coli (periplasmic)Better folding, less proteolysisLower yieldC-terminal Strep-tag
Cyanobacterial hostNative-like folding and processingLower yield, slower growthC-terminal His6 with native signal peptide

Methodological consideration: When expressing apocytochrome f, researchers must decide whether to co-express heme attachment machinery or purify the apoprotein form. For structural studies of the apoprotein, E. coli expression without heme incorporation may be sufficient, while functional studies require proper heme attachment .

What analytical techniques are most informative for characterizing the structural integrity of Recombinant M. aeruginosa Apocytochrome f?

Comprehensive characterization of Recombinant M. aeruginosa Apocytochrome f requires multiple complementary techniques:

Spectroscopic Methods:

  • UV-Visible Spectroscopy: Apoprotein vs. holoprotein distinction; the apoform lacks characteristic heme absorption bands at ~550 nm and ~520 nm

  • Circular Dichroism (CD): Secondary structure assessment, particularly alpha-helical content

  • Fluorescence Spectroscopy: Tertiary structure evaluation through intrinsic tryptophan fluorescence

Mass Spectrometry Approaches:

  • ESI-MS: Intact mass determination to confirm proper processing and potential post-translational modifications

  • LC-MS/MS following proteolytic digestion: Sequence verification and identification of modified residues

  • HDX-MS (Hydrogen-Deuterium Exchange): Conformational dynamics assessment

Functional Assays:

  • Electron transfer capacity measurement: Using artificial electron donors/acceptors

  • Heme incorporation efficiency: Monitored spectroscopically upon reconstitution with heme

  • Interaction studies: Surface plasmon resonance with binding partners from the cytochrome b6f complex

When conducting these analyses, researchers should store the recombinant protein at -20°C in Tris-based buffer with 50% glycerol to maintain stability, avoiding repeated freeze-thaw cycles .

How can researchers effectively use site-directed mutagenesis to investigate functional domains of petA?

Site-directed mutagenesis is a powerful approach for investigating functional domains of petA:

Key Residues for Mutagenesis:

  • Heme-binding site (CXXCH motif): Mutations of C35 or C38 will prevent heme attachment, creating permanently locked apoprotein forms

  • Electron transfer pathway residues: Mutations in conserved aromatic residues can modulate electron transfer efficiency

  • Membrane anchor region: Truncations or hydrophobicity alterations can investigate membrane association requirements

Methodological Workflow:

  • Identify conservation patterns through multiple sequence alignment of petA across cyanobacterial species

  • Design primers containing desired mutations with appropriate mismatch parameters

  • Perform PCR-based mutagenesis (e.g., QuikChange method or overlap extension PCR)

  • Verify mutations by sequencing

  • Express wild-type and mutant proteins under identical conditions

  • Compare spectroscopic properties, stability, and functional parameters

Applications to Study Cytochrome Oxidation:
Recent research on apocytochromes has revealed complex oxidation mechanisms involving disulfide bond formation . Researchers can exploit this by introducing cysteine pairs at different locations to probe folding intermediates and oxidation pathways specific to M. aeruginosa apocytochrome f, which may be particularly relevant given the oxidative stress conditions during cyanobacterial blooms .

How can proteomics approaches be applied to study petA expression in different M. aeruginosa strains and environmental conditions?

Proteomics offers powerful insights into petA expression and its regulation:

Sample Preparation Considerations:

  • Cell disruption must preserve membrane protein integrity (gentle sonication in the presence of detergents)

  • Fractionation to enrich membrane proteins (e.g., sucrose gradient ultracentrifugation)

  • Appropriate detergent selection (e.g., DDM or CHAPS) for solubilization

Quantitative Proteomics Workflow:

  • Label cells from different conditions using metabolic (SILAC) or chemical (TMT, iTRAQ) labeling

  • Extract and fractionate proteins, with particular attention to membrane-enriched fractions

  • Perform LC-MS/MS analysis with DDA or DIA acquisition modes

  • Process data with appropriate software (MaxQuant, Proteome Discoverer, Skyline)

  • Validate findings with targeted proteomics (PRM or MRM) for petA and related proteins

Comparative Proteomic Findings:
Studies comparing toxic and non-toxic M. aeruginosa strains have identified significant strain-specific differences in protein expression profiles . In one study, 475 proteins were identified reproducibly across strains, with 82 comprising the core proteome . Photosynthesis-related proteins, including components of electron transport, showed differential expression patterns between toxic and non-toxic strains, highlighting the potential regulatory connection between photosynthesis efficiency and toxin production .

What experimental designs are most appropriate for studying the impact of environmental stressors on petA expression and function?

When investigating how environmental factors affect petA expression and function in M. aeruginosa, consider these experimental approaches:

Microcosm Experiment Design:

  • Culture M. aeruginosa under controlled laboratory conditions with defined media

  • Introduce specific stressors (e.g., nutrient limitation, heavy metals, light intensity variations)

  • Monitor growth parameters and collect samples at defined intervals

  • Analyze petA expression (transcriptomics), protein levels (proteomics), and functional parameters

Recommended Stressors to Investigate:

  • Cadmium exposure: Research shows Cd at concentrations of 0.0125-0.2000 mg/L can induce colony formation and alter protein expression in M. aeruginosa

  • Nitrogen source variation: Different nitrogen sources significantly impact protein expression patterns in cyanobacteria

  • Phage infection: Cyanophage Mic1 infection causes significant transcriptomic changes affecting metabolic pathways

Data Collection and Analysis Framework:

ParameterMethodTimepointsControls
GrowthCell counting, optical densityEvery 12hUnstressed culture
petA mRNART-qPCR0h, 6h, 24h, 48hHousekeeping genes
petA proteinWestern blot/targeted proteomics0h, 24h, 48h, 72hTotal protein loading
Photosynthetic efficiencyPAM fluorometryEvery 24hDark-adapted samples
Microcystin concentrationELISA/LC-MS0h, 48h, 96hCertified standard

This experimental framework follows established principles for proper experimental design in biological research , including appropriate controls, statistical planning, and pilot studies to optimize protocols.

How can researchers differentiate between direct and indirect effects of microcystin on petA and the photosynthetic apparatus?

Distinguishing direct from indirect effects of microcystin on petA requires sophisticated experimental approaches:

In Vitro Binding Studies:

  • Express and purify Recombinant M. aeruginosa Apocytochrome f

  • Perform direct binding assays with purified microcystin variants using:

    • Isothermal titration calorimetry (ITC)

    • Microscale thermophoresis (MST)

    • Bio-layer interferometry (BLI)

Genetic Manipulation Approaches:

  • Compare wild-type toxin-producing strains with:

    • Microcystin-deficient mutants (MT)

    • Naturally non-toxic strains (NT)

    • Complemented strains where microcystin production is restored

  • Measure petA expression and function across these genetic backgrounds

Co-culture Experiments:
Research has demonstrated that co-culturing toxic and non-toxic M. aeruginosa strains affects the production of secondary metabolites . In one study, when a wild-type toxin-producing strain (WT) was co-cultured with a naturally non-toxic strain (NT), the NT exhibited a higher growth rate (0.15 ± 0.005 day⁻¹) than the WT (0.10 ± 0.015 day⁻¹) . Such co-culture systems can be adapted to study petA expression dynamics.

Exogenous Microcystin Addition:
Adding purified microcystin to non-toxic cultures has been shown to affect protein function . Research demonstrated that allergenicity of M. aeruginosa was inhibited in a dose-dependent manner by microcystin toxin , suggesting microcystin may interact with proteins beyond those directly involved in its biosynthesis.

What are the ethical considerations and alternatives when using animal models to study the immunogenicity of recombinant proteins from M. aeruginosa?

Researchers studying immunogenic properties of M. aeruginosa proteins, including recombinant apocytochrome f, should consider:

Ethical Framework for Animal Studies:

  • Follow the 3Rs principle: Replacement, Reduction, Refinement

  • Ensure all animal studies have proper IACUC approval and oversight

  • Consider sample size determination and statistical power to minimize animal usage

  • Implement pilot studies to optimize protocols before larger-scale experiments

Available Alternatives to Animal Testing:

Alternative ApproachApplicationAdvantagesLimitations
Recombinant antibody technologyGeneration of antibodies against petAAnimal-free, consistent qualityMay miss conformational epitopes
Cell-based assaysImmunogenic potential assessmentHigher throughput, defined conditionsSimplified system
In silico epitope predictionIdentification of potentially immunogenic regionsNo biological materials neededRequires validation
Human serum screeningCross-reactivity with existing antibodiesDirectly relevant to human exposureLimited availability of samples

Recombinant Antibody Options:
The "Recombinant Antibody Challenge" offers grants for animal-free antibodies for use in in vitro research and testing . This represents an ethical alternative to traditional antibody production methods that can cause animal suffering. Recombinant antibodies offer numerous scientific advantages over animal-derived antibodies, including high affinity and specificity, faster generation time, reduced immunogenicity, and the ability to control selection conditions .

When studying potential allergenic properties of M. aeruginosa proteins, researchers should be aware that phycobiliproteins have been identified as relevant sensitizing proteins . Any study design must consider this potential risk while minimizing animal usage through alternative methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.