Recombinant Microcystis aeruginosa ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpE; atpH; MAE_50120; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-81
Protein Length
full length protein
Species
Microcystis aeruginosa (strain NIES-843)
Target Names
atpE
Target Protein Sequence
MNPTVAAASVIAAALAVGLAAIGPGVGQGTASGEAVSGIARQPEAEGRIRGTLLLSLAFM ESLTIYGLVIALVLLFANPFA
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. A key component of the F0 channel, the c-subunit directly participates in transmembrane translocation. A homomeric c-ring, consisting of 10-14 subunits, forms the central stalk rotor element with the F1 δ and ε subunits.
Database Links
Protein Families
ATPase C chain family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the ATP synthase subunit c (atpE) in cyanobacteria like Microcystis aeruginosa?

ATP synthase subunit c forms a cylindrical oligomeric structure (c-ring) in the membrane domain (F0) of the ATP synthase complex. This structure plays a crucial role in proton translocation, converting proton gradient energy into mechanical energy that drives ATP synthesis. In cyanobacteria, this protein functions in both thylakoid membranes during photosynthesis and cytoplasmic membranes during respiration. ATP synthase subunit c contains approximately 76 amino acids in its mature form after the cleavage of its mitochondrial targeting peptide (in eukaryotes), though targeting mechanisms differ in prokaryotic cyanobacteria .

How does ATP synthase subunit c contribute to the bioenergetics of Microcystis aeruginosa?

The c subunit assembles into a ring structure (c-ring) comprising multiple identical copies. This ring rotates as protons flow through the complex, with the rotation coupled to the F1 portion that catalyzes ATP synthesis. The number of c subunits in the ring directly determines the H+/ATP ratio, affecting bioenergetic efficiency. A larger c-ring requires more protons per ATP but can operate under smaller proton motive force, which may be an adaptation to variable environmental conditions faced by Microcystis in aquatic ecosystems. The subunit c structure is particularly important as it contains the essential carboxylate residue that undergoes protonation/deprotonation during the catalytic cycle .

What structure-function relationships are known in ATP synthase subunit c?

The key functional elements of ATP synthase subunit c include:

  • Transmembrane helices: Typically two hydrophobic alpha-helical domains spanning the membrane

  • Conserved carboxylate residue: An essential acidic residue (aspartate or glutamate) necessary for proton translocation

  • Oligomeric assembly: Formation of the c-ring through precise subunit-subunit interactions

Mutations in these regions can significantly affect function. For example, in Mycobacterium abscessus, mutations D29V and A64P in ATP synthase subunit c confer high resistance to the inhibitor bedaquiline by interfering with drug binding while preserving ATP synthase function . Similar structure-function principles likely apply to Microcystis aeruginosa atpE, though species-specific variations would affect inhibitor binding and c-ring assembly properties.

What expression systems are most effective for recombinant Microcystis aeruginosa atpE?

Several expression systems can be considered, each with distinct advantages:

Expression SystemAdvantagesChallengesRecommended Conditions
Homologous (M. aeruginosa)Native folding, post-translational modificationsLower yields, difficult transformationElectroporation at 8.5-10 kV/cm field strength
E. coli (heterologous)High yield, established protocolsMembrane protein folding issuesC41/C43 strains, low temperature (18-20°C), fusion tags
Yeast systemsBetter for membrane proteinsLower yield than bacteriaP. pastoris with methanol-inducible promoters

For functional studies requiring proper folding and assembly, homologous expression in Microcystis aeruginosa may be preferable despite lower yields. For structural studies requiring larger quantities, E. coli expression with optimization for membrane proteins is often more practical.

How can I optimize transformation efficiency when working with Microcystis aeruginosa?

Based on established protocols for cyanobacterial transformation, the following optimized method can significantly improve transformation efficiency in Microcystis aeruginosa:

  • Pre-transformation preparation:

    • Use cells at mid-logarithmic or stationary phase (concentrated to 10^9 cells/ml)

    • Wash cells three times with cold 0.1 mM HEPES (pH 7.2) or try 10% ice-cold sterile glycerol

    • Allow pre-pulse contact with methylated DNA construct on ice for 1-2 hours

  • Electroporation parameters:

    • BioRad Gene Pulser with 25-μF capacitator and 400 ohms resistance

    • Test field strengths between 2.5-12.5 kV/cm (optimal typically around 8.5-10 kV/cm)

    • Use cuvettes with 2-mm gap between electrodes

  • Post-electroporation recovery:

    • Immediately add 2 ml cold sterile BG11 medium after the electric pulse

    • Culture in BG11 without selection antibiotic for one day

    • Then transfer to selective media (e.g., BG11 with chloramphenicol)

This methodology has been shown to produce successful transformants in Microcystis aeruginosa PCC7806, though transformation efficiency remains relatively low compared to model organisms .

What purification strategies yield the highest purity and activity for recombinant atpE?

Purification of recombinant ATP synthase subunit c requires specialized approaches due to its hydrophobic nature:

Purification StageMethodCritical ParametersPurpose
SolubilizationDetergent extractionDDM, LDAO, or digitonin; maintain CMCExtract from membrane
Primary purificationAffinity chromatographyHis-tag, gentle elution gradientCapture target protein
Secondary purificationSize exclusionBuffer optimization, detergent maintenanceSeparate oligomeric forms
Alternative approachesOrganic solvent extractionChloroform/methanol mixtureFor structural studies
Functional reconstitutionBicelle/nanodisc formationLipid composition, protein:lipid ratioFor activity assays

The critical consideration is maintaining the native oligomeric state throughout purification if functional studies are planned. For structural studies of the c-ring, crosslinking prior to purification may help preserve the complex.

How can ATP synthase activity be reliably measured in recombinant systems?

Multiple complementary approaches can assess ATP synthase functionality:

MethodMeasurementAdvantagesLimitations
Luciferase-based ATP assaysATP production rateQuantitative, sensitiveIndirect measurement
Oxygen consumptionRespiratory rateReal-time measurement in intact cellsNot specific to ATP synthase
Proton translocationpH changes with fluorescent dyesDirectly measures proton movementTechnical complexity
ATP hydrolysis (reverse reaction)Pi release or NADH oxidationEasier than synthesis assaysNot physiological direction
Membrane potential assaysFluorescent potential-sensitive dyesMeasures driving forceInterference from other complexes

For comprehensive characterization, researchers should combine multiple methods. When comparing wild-type and mutant variants, standardized conditions are essential to accurately assess how genetic modifications affect ATP synthase function.

What genetic manipulation strategies allow functional studies of atpE in Microcystis aeruginosa?

Several genetic approaches can be employed to study atpE function:

  • Gene disruption via homologous recombination:

    • Design construct with antibiotic resistance cassette flanked by homologous regions of atpE

    • Use optimized electroporation protocol with field strengths of 8.5-10 kV/cm

    • Select transformants on chloramphenicol-containing media

    • Verify disruption by PCR and phenotypic analysis

  • Site-directed mutagenesis:

    • Target conserved functional residues (e.g., the essential carboxylate residue)

    • Similar mutations to those studied in other organisms (e.g., D29V, A64P) can provide insights into inhibitor binding and function

    • Study resulting phenotypic changes in ATP synthesis efficiency

  • Complementation studies:

    • Express wild-type or mutant variants in atpE-deficient strains

    • Test ability to restore ATP synthesis function

    • Can identify critical functional domains

The methodology described in search result for gene disruption in Microcystis aeruginosa provides a foundation for these genetic approaches, though optimization for specific experimental goals may be necessary.

How do environmental factors affect ATP synthase activity in Microcystis aeruginosa?

Environmental factors significantly influence ATP synthase function in Microcystis aeruginosa, which is particularly important given its role in harmful algal blooms:

Environmental FactorEffect on ATP SynthaseExperimental ApproachEcological Relevance
Light intensityAffects proton gradient through photosynthesisMeasure ATP synthesis under different light regimesBloom formation dynamics
TemperatureAlters enzyme kinetics and membrane fluidityCompare activity across temperature rangeSeasonal bloom patterns
pHChanges proton availability for translocationBuffer systems with controlled pHDiurnal pH fluctuations in blooms
Nutrient availabilityAffects energy demand and allocationATP synthesis rates under different nutrient conditionsBloom sustainability
Toxin productionPotential metabolic burdenCompare wild-type and mcyB-deficient strains Energy allocation during toxin production

Understanding these relationships requires integrated studies combining bioenergetics measurements with ecological parameters, providing insights into both basic biology and harmful algal bloom dynamics.

How can analysis of atpE mutations inform inhibitor development against harmful algal blooms?

ATP synthase inhibitor development based on atpE analysis involves several strategic approaches:

  • Comparative genomic analysis:

    • Identify unique sequences or structural features in Microcystis aeruginosa atpE

    • Compare with non-target organisms to maximize selectivity

    • Focus on regions that differ from beneficial phytoplankton

  • Mutation-based insights:

    • Study naturally occurring resistance mutations (similar to D29V and A64P characterized in Mycobacterium abscessus)

    • Map these to structural models to identify critical binding pockets

    • Design inhibitors that maintain binding despite common resistance mutations

  • Structure-based drug design:

    • Develop homology models based on related ATP synthase structures

    • Virtual screening against identified binding sites

    • Rational design of compounds targeting cyanobacteria-specific features

  • Testing pipeline:

    • In vitro enzyme inhibition assays

    • Cell-based growth inhibition

    • Microcosm studies with mixed communities to assess selectivity

    • Evaluation of resistance development potential

This approach could lead to selective ATP synthase inhibitors that specifically target Microcystis aeruginosa while minimizing impact on beneficial aquatic organisms.

What is the relationship between ATP synthase function and microcystin production?

The relationship between ATP synthase and microcystin production represents an important but underexplored research area:

AspectResearch QuestionExperimental ApproachCurrent Understanding
Energetic requirementsDoes microcystin production strain cellular energy resources?Compare ATP levels during toxin production phasesMicrocystin synthesis through NRPS and PKS systems requires significant ATP
Regulatory interactionsDo common signaling pathways regulate both systems?Transcriptomics under various environmental conditionsBoth systems respond to light and nutrient availability
Genetic linkageDoes ATP synthase efficiency affect toxin production?Create atpE mutants with altered efficiency and measure toxin outputLimited information available, represents research gap
Evolutionary significanceWhy maintain energetically expensive toxin production?Comparative analysis across toxic and non-toxic strainsMay provide competitive advantage despite energy cost

Experimental approaches should include comparative studies of wild-type and microcystin-deficient strains (such as mcyB mutants) , temporal analysis of ATP synthase activity during bloom development, and integrated multi-omics studies capturing both energy metabolism and toxin production networks.

What proteomic approaches best characterize atpE interactions and regulatory mechanisms?

Advanced proteomics provide critical insights into ATP synthase subunit c interactions:

  • Crosslinking-mass spectrometry (XL-MS):

    • Chemical crosslinking captures transient protein-protein interactions

    • MS identification of crosslinked peptides reveals spatial relationships

    • Particularly valuable for mapping interactions between atpE and other ATP synthase subunits

  • Co-immunoprecipitation with tandem mass spectrometry:

    • Pull-down of atpE using specific antibodies or epitope tags

    • MS identification of co-precipitated proteins

    • Reveals interaction partners in the ATP synthase complex and regulatory proteins

  • Post-translational modification (PTM) mapping:

    • Phosphoproteomics to identify regulatory phosphorylation sites

    • Redox proteomics to detect oxidative modifications

    • PTM analysis under different environmental conditions explains regulatory mechanisms

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Measures protein dynamics and conformational changes

    • Can identify regions involved in conformational shifts during catalysis

    • Useful for studying inhibitor binding effects

These complementary approaches provide a comprehensive view of atpE structural organization, interaction dynamics, and regulatory modifications within the ATP synthase complex.

What are the main challenges in expressing and purifying functional ATP synthase subunit c?

Working with ATP synthase subunit c presents several technical challenges that require specific solutions:

ChallengeCauseSolutionValidation Method
Low expression yieldMembrane protein toxicity to host cellsUse specialized expression strains (C41/C43); tune expression levelsWestern blot quantification
Improper membrane insertionHydrophobic nature disrupts cellular membranesCo-expression with chaperones; lower induction temperatureMembrane fraction analysis
Oligomeric state preservationc-ring disassembly during purificationCrosslinking; careful detergent selection; native extraction techniquesBlue native PAGE; electron microscopy
Functional assessmentRequires complete ATP synthase complexReconstitution with other subunits; liposome incorporationATP synthesis assays
Protein aggregationHydrophobic interactionsOptimize solubilization conditions; use fusion partnersSize exclusion chromatography

Addressing these challenges requires systematic optimization of expression and purification protocols, with careful attention to maintaining the native structure and function of the protein.

How can I troubleshoot transformation failures in Microcystis aeruginosa?

Transformation of Microcystis aeruginosa is challenging, but systematic troubleshooting can improve success rates:

  • DNA purity and methylation issues:

    • Problem: Restriction systems degrading foreign DNA

    • Solution: Methylate construct with CpG methylase before transformation

    • Validation: Verify methylation status with restriction enzyme digestion

  • Electroporation parameters:

    • Problem: Cell damage or insufficient permeabilization

    • Solution: Test multiple field strengths between 2.5-12.5 kV/cm

    • Validation: Measure cell viability post-electroporation

  • Recovery conditions:

    • Problem: Cells unable to recover from transformation stress

    • Solution: Extend recovery period in non-selective media; optimize light conditions (14 μmol·m^-2·s^-1)

    • Validation: Monitor cell growth microscopically

  • Selection stringency:

    • Problem: Selection pressure too high for weakened transformants

    • Solution: Use lower initial antibiotic concentrations with gradual increase

    • Validation: Compare transformation efficiency at different selective pressures

  • Construct design:

    • Problem: Insufficient homology for recombination

    • Solution: Extend homologous regions (>500 bp on each side)

    • Validation: PCR verification of integration

By systematically addressing each potential issue, researchers can significantly improve transformation success rates in this challenging organism.

What are the most reliable methods to confirm successful atpE modification?

Verification of genetic modifications to atpE requires multiple complementary approaches:

A comprehensive verification strategy should include genetic confirmation (PCR/sequencing), protein expression verification (Western blot), and functional assessment (ATP synthesis assays). For critical research applications, whole genome sequencing should be considered to rule out off-target effects that might confound results.

How might CRISPR-Cas9 technology advance atpE functional studies in Microcystis aeruginosa?

CRISPR-Cas9 technology offers transformative potential for atpE studies:

  • Precise gene editing capabilities:

    • Introduction of point mutations to study structure-function relationships

    • Creation of site-specific mutations analogous to those conferring inhibitor resistance (e.g., D29V, A64P)

    • Generation of tagged versions for localization studies

  • Implementation considerations:

    • Adapt electroporation protocol from search result for CRISPR components

    • Design guide RNAs specific to Microcystis aeruginosa atpE

    • Provide DNA repair templates with appropriate homology arms

  • Advanced applications:

    • CRISPRi for tunable gene expression without permanent modification

    • Multiplex editing to study interactions with other ATP synthase components

    • Base editing for precise nucleotide changes without double-strand breaks

  • Technical advantages:

    • Higher efficiency than traditional homologous recombination

    • Reduced off-target effects with engineered Cas9 variants

    • Possibility of marker-free modifications

CRISPR technology could overcome many limitations of current genetic manipulation approaches in Microcystis aeruginosa, enabling more sophisticated functional studies of ATP synthase.

What emerging structural biology techniques could enhance our understanding of atpE?

Several cutting-edge structural biology methods hold promise for deepening our understanding of ATP synthase subunit c:

TechniqueApplication to atpEExpected InsightsTechnical Requirements
Cryo-electron microscopyWhole ATP synthase complex visualizationc-ring stoichiometry; subunit interactionsPurified intact complex; specialized equipment
AlphaFold2/RoseTTAFoldComputational structure predictionStructural features specific to Microcystis atpEComputing resources; experimental validation
Solid-state NMRMembrane-embedded c-ring analysisDynamic properties; lipid interactionsIsotope labeling; specialized equipment
smFRETSingle-molecule studiesConformational changes during catalysisSite-specific fluorophore labeling
Microcrystal electron diffractionStructure from small crystalsHigh-resolution details of c-ring assemblySpecialized crystallization; data processing

These techniques could reveal species-specific structural features of Microcystis aeruginosa ATP synthase subunit c, interactions with inhibitors, and dynamic conformational changes during function.

How can systems biology approaches integrate ATP synthase function with broader cellular networks?

Systems biology offers powerful frameworks to contextualize ATP synthase within cellular networks:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Map ATP synthesis flux to cellular energy demands

    • Identify regulatory networks connecting ATP synthase to other cellular processes

  • Flux balance analysis:

    • Develop genome-scale metabolic models incorporating ATP synthesis

    • Predict metabolic shifts under different environmental conditions

    • Model the energetic consequences of atpE mutations

  • Network analysis:

    • Map protein-protein interaction networks centered on ATP synthase

    • Identify hub proteins that connect energy metabolism to other cellular functions

    • Discover potential regulatory mechanisms linking ATP production to toxin synthesis

  • Environmental response modeling:

    • Integrate environmental sensor data with cellular response models

    • Predict ATP synthesis dynamics during bloom formation and collapse

    • Model energy allocation during stress responses

This systems-level understanding would contextualize molecular findings about atpE within the broader cellular and ecological context of Microcystis aeruginosa, potentially revealing new intervention points for harmful algal bloom control.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.