Recombinant Microcystis aeruginosa Cytochrome b6-f complex iron-sulfur subunit (petC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
petC; MAE_19220; Cytochrome b6-f complex iron-sulfur subunit; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Microcystis aeruginosa (strain NIES-843)
Target Names
petC
Target Protein Sequence
MSQVSGTDVPDLGRRQFMNLLTFGTITGVAAGALYPIVKYFIPPSAGGTGGGVTAKDALG NDVIVSQFLTSHNAGDRTLAQGLKGDPTYLVVQEDKTLANYGINAVCTHLGCVVPWNASE EKFMCPCHGSQYNAEGKVVRGPAPLSLALAHANVTDNDKVVFSTWTETDFRTGEEPWWS
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what is its role in photosynthesis?

The cytochrome b6-f complex occupies a central position in the sequence of photosynthetic electron transport carriers. It oxidizes plastoquinol (PQH2) and provides the electron transfer connection between the two reaction center complexes, Photosystem II and Photosystem I. This electron transfer is coupled to H+ transfer across the thylakoid membrane, contributing to the trans-membrane proton gradient that drives ATP synthesis. Electrons are transferred from the complex to PSI via plastocyanin or cytochrome c6 .

The complex has been shown by biochemical and mass spectroscopic analysis to exist as a dimer containing 8 tightly bound subunits per monomer (monomer MW = 108,500) in cyanobacteria such as M. laminosus, and 9 subunits in plant chloroplasts. The additional subunit in plant complexes is ferredoxin:NADP-reductase (FNR), which is relevant to cyclic electron transfer linked to Photosystem I . Functionally, the b6-f complex is analogous to the cytochrome bc1 complex from the mitochondrial respiratory chain.

What is the PetC subunit and what is its specific function within the complex?

PetC, the Rieske iron-sulfur protein of the cytochrome b6-f complex, is a crucial component with an apparent molecular weight of approximately 23 kDa . This protein contains an iron-sulfur cluster that plays a key role in electron transfer within the complex.

The significance of PetC in the assembly and function of the cytochrome b6-f complex has been demonstrated in mutant studies. Research on Lemna perpusilla showed that a mutant containing less than 1% of the four protein subunits of the complex had significantly reduced levels of translationally active mRNA for the nuclear-encoded Rieske Fe-S protein (petC), with a reduction of greater than 100-fold compared to wild type . This finding suggests that PetC is essential for the proper assembly and stability of the entire cytochrome b6-f complex.

How conserved is the PetC protein across photosynthetic organisms?

The PetC protein shows strong conservation across diverse photosynthetic organisms. Antibodies raised against a synthetic peptide derived from conserved regions of PetC demonstrate reactivity with this protein from numerous species, including Arabidopsis thaliana, Chlamydomonas reinhardtii, Spinacia oleracea, various cyanobacteria including Synechococcus PCC 7942 and Synechocystis sp. PCC 6803, and several other photosynthetic organisms .

Importantly, Microcystis aeruginosa is listed among species with predicted reactivity to anti-PetC antibodies , indicating significant structural conservation of this protein in this cyanobacterial species. This conservation reflects the fundamental importance of the Rieske iron-sulfur protein in photosynthetic electron transport across evolutionary diverse photosynthetic organisms.

What expression systems are most effective for recombinant PetC from cyanobacteria?

While the specific expression of recombinant PetC from M. aeruginosa is not directly addressed in the search results, insights can be drawn from related research on cyanobacterial proteins. E. coli-based expression systems have been successfully employed for heterologous expression of proteins from cyanobacteria.

For example, researchers have used the E. coli BAP1 strain, which contains a chromosomal copy of the sfp gene encoding a promiscuous phosphopantetheinyl transferase, for the expression of cyanobacterial gene clusters . When designing an expression system for PetC, consideration should be given to the proper folding and incorporation of the iron-sulfur cluster, which may require specialized expression strains or growth conditions.

A promising approach could involve a modified pET-28 vector backbone with an appropriate promoter (such as PtetO) and potentially a C-terminal fusion tag to aid in purification and stability assessment . For difficult-to-express membrane-associated proteins like components of the cytochrome b6-f complex, optimization of growth temperature, inducer concentration, and media composition may be necessary.

What isolation and purification strategies are most effective for recombinant cyanobacterial proteins?

Based on successful approaches with other cyanobacterial proteins, affinity chromatography using a His-tag is a viable initial purification strategy for recombinant PetC. For instance, the NtcA transcription factor from M. aeruginosa PCC 7806 was successfully purified following His-tag fusion expression .

The purification protocol would typically involve:

  • Cell lysis under conditions that preserve protein structure and the iron-sulfur cluster

  • Initial purification via immobilized metal affinity chromatography (IMAC)

  • Further purification steps such as ion exchange or size exclusion chromatography to achieve high purity

  • Quality assessment via SDS-PAGE and Western blotting using anti-PetC antibodies

Throughout the purification process, reducing conditions should be maintained to preserve the integrity of the iron-sulfur cluster. Additionally, buffer optimization may be necessary to ensure protein stability and activity.

What challenges are specific to the expression of iron-sulfur proteins like PetC?

Expression of functional iron-sulfur proteins presents several unique challenges:

  • Iron-sulfur cluster assembly: The proper formation and insertion of the Fe-S cluster is crucial for PetC function. This may require co-expression of iron-sulfur cluster assembly proteins or growth under conditions that promote cluster formation.

  • Protein solubility: As part of a membrane protein complex in its native environment, recombinant PetC may have solubility issues when expressed heterologously. This might necessitate the use of solubility-enhancing fusion tags or detergents.

  • Protein stability: The stability of PetC may depend on interactions with other subunits of the cytochrome b6-f complex. Research on a Lemna perpusilla mutant lacking the cytochrome b6-f complex showed that protein turnover rates of complex components were affected , suggesting interdependence between subunits for stability.

  • Functional assessment: Verifying that the recombinant protein contains a properly formed iron-sulfur cluster and is capable of electron transfer activity requires specialized spectroscopic and biochemical techniques.

What spectroscopic methods are most informative for analyzing recombinant PetC?

Several spectroscopic techniques provide valuable information about the structure and function of recombinant PetC:

TechniqueInformation ObtainedTechnical Requirements
UV-visible absorption spectroscopyPresence and oxidation state of Fe-S clusterRelatively simple; requires purified protein
Electron Paramagnetic Resonance (EPR)Electronic structure of Fe-S clusterSpecialized equipment; low temperature measurements
Circular Dichroism (CD)Secondary structure contentModerate complexity; sensitive to buffer conditions
Mössbauer spectroscopyIron oxidation states and coordinationHighly specialized; requires 57Fe enrichment
Resonance Raman spectroscopyFe-S cluster vibrational modesSpecialized equipment; sensitive to photodamage

These complementary techniques can confirm whether the recombinant PetC contains a properly assembled iron-sulfur cluster and maintains its native structure, which is essential for functional studies.

How can researchers verify the electron transfer function of recombinant PetC?

Verification of electron transfer function can be approached through several experimental strategies:

  • In vitro electron transfer assays: Using artificial electron donors and acceptors to measure the electron transfer capability of the purified protein.

  • Reconstitution experiments: Incorporating recombinant PetC into isolated cytochrome b6-f complexes lacking this subunit, followed by activity assays.

  • Complementation studies: Expressing recombinant PetC in mutants lacking this protein (similar to the Lemna perpusilla mutant described in ) to assess functional rescue.

  • Electrochemical techniques: Protein film voltammetry can provide information about the redox properties of the iron-sulfur cluster in PetC.

For a comprehensive functional assessment, researchers should combine multiple approaches, as each provides different insights into the electron transfer capabilities of the recombinant protein.

What protein-protein interaction studies are valuable for understanding PetC's role in the complex?

  • Co-immunoprecipitation: Using antibodies against PetC to pull down interacting partners from solubilized membrane preparations.

  • Cross-linking coupled with mass spectrometry: Identifying proximity relationships between PetC and other subunits within the intact complex.

  • Yeast two-hybrid or bacterial two-hybrid assays: Screening for specific interactions between PetC and other subunits of the complex.

  • Blue Native PAGE: Analyzing the integration of recombinant PetC into the native complex. Anti-PetC antibodies have been tested and validated for Blue Native PAGE applications .

Research on the Lemna perpusilla mutant demonstrated that the absence of the Rieske Fe-S protein affected the stability of other complex components , highlighting the interconnected nature of subunit interactions within the cytochrome b6-f complex.

How can site-directed mutagenesis of PetC contribute to understanding electron transport mechanisms?

Site-directed mutagenesis of PetC offers powerful insights into structure-function relationships within the protein:

  • Identification of critical residues: Mutations of conserved residues coordinating the iron-sulfur cluster can reveal their importance for cluster stability and electron transfer.

  • Proton-coupled electron transfer: Mutations of residues near the quinol binding site can help elucidate how electron transfer is coupled to proton translocation.

  • Interaction interfaces: Altering residues at predicted interfaces with other subunits can reveal the structural basis for complex assembly.

  • Redox potential modulation: Systematic mutations around the iron-sulfur cluster can identify factors that influence its redox potential, which is crucial for the directional flow of electrons.

The efficacy of mutagenesis studies can be enhanced by combining them with the spectroscopic and functional analyses described previously, providing a comprehensive view of how specific residues contribute to PetC function.

What is the relationship between PetC function and cyanobacterial bloom dynamics?

Research on photosynthetic proteins like PetC has important implications for understanding and potentially controlling cyanobacterial blooms, particularly those formed by Microcystis aeruginosa:

  • Energy generation and growth: As a key component of photosynthetic electron transport, PetC directly influences energy production and therefore the growth potential of cyanobacteria under different environmental conditions.

  • Adaptation to environmental stressors: Understanding how the cytochrome b6-f complex responds to environmental factors (light intensity, nutrient availability, temperature) can provide insights into bloom formation triggers.

  • Early detection strategies: Similar to the approach used for toxin-encoding genes (mcyA) , molecular detection methods targeting photosynthetic genes like petC could potentially be developed for early bloom monitoring.

  • Potential intervention targets: Detailed knowledge of critical photosynthetic proteins could inform the development of targeted interventions that specifically disrupt cyanobacterial photosynthesis without broader ecological impacts.

The growth dynamics of Microcystis cultures show specific patterns, with high-inoculation cultures exhibiting specific growth rates of 0.85 day^-1 on day two and 1.12 day^-1 on day four before dropping to mean growth rates . Understanding how photosynthetic efficiency relates to these growth patterns could provide valuable insights into bloom development.

How does nitrogen status affect cytochrome b6-f complex assembly and PetC expression?

Nitrogen availability is a critical factor affecting cyanobacterial physiology and bloom formation. The relationship between nitrogen status and photosynthetic protein expression involves several regulatory mechanisms:

  • NtcA regulation: NtcA is a transcription factor that responds to nitrogen availability in cyanobacteria. In M. aeruginosa PCC 7806, NtcA has been shown to be autoregulatory and binds to specific promoter regions to control gene expression . While direct regulation of petC by NtcA has not been demonstrated in the search results, the involvement of NtcA in regulating key metabolic processes suggests potential indirect effects on photosynthetic protein expression.

  • Resource allocation: Under nitrogen limitation, cyanobacteria undergo extensive metabolic remodeling, potentially affecting the allocation of resources to photosynthetic apparatus assembly.

  • Photosynthetic complex stoichiometry: Changes in nitrogen availability may alter the relative abundance of different photosynthetic complexes, including the cytochrome b6-f complex, to optimize energy production under prevailing conditions.

Understanding these regulatory mechanisms could provide insights into how nitrogen pollution might influence cyanobacterial bloom formation through effects on photosynthetic efficiency.

What computational approaches can enhance PetC structure-function studies?

Computational methods provide valuable complementary approaches to experimental studies of PetC:

These computational approaches are particularly valuable when combined with experimental validation, providing a more complete understanding of PetC structure and function than either approach alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.