Recombinant Microcystis aeruginosa Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Comparative Analysis of lspA Across Organisms

OrganismKey FeaturesRole in Virulence/PathogenicityExpression PatternsInhibition by Globomycin
Rickettsia typhiHigh conservation of catalytic domains; low complementation in E. coli Critical for intracellular growthPeaks at 48h post-infectionYes
Staphylococcus aureusCrystal structures reveal substrate-binding sites Non-essential but virulence attenuation in mutantsNot studiedSensitive
Microcystis aeruginosaRecombinant protein available; function inferred from homologs Hypothetical role in membrane protein biogenesisNot studiedHypothetical

Mechanistic Insights and Inhibition

LspA’s catalytic mechanism involves an aspartic acid dyad (Asp-boxes), conserved across species. Inhibitors like globomycin target this site, disrupting prolipoprotein processing and bacterial growth . While M. aeruginosa lspA’s sensitivity to globomycin remains untested, structural homology suggests potential utility in biofilm disruption or toxin production studies.

Future Research Directions

  1. Enzymatic Activity: Biochemical assays to confirm substrate specificity and catalytic efficiency.

  2. Membrane Protein Profiling: Identification of M. aeruginosa lipoproteins dependent on lspA.

  3. Environmental Relevance: Linking lspA activity to toxin secretion (e.g., microcystin) or bloom persistence.

  4. Drug Targeting: Screening for inhibitors against cyanobacterial lspA to mitigate harmful blooms.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order remarks. We will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; MAE_00150; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Microcystis aeruginosa (strain NIES-843)
Target Names
lspA
Target Protein Sequence
MFKKNRWFWIVAVIGLILDQVTKYITVQSFEQIGDTFPIIPGVFHFTYVINTGAAFSAFR GGVGWLKWLSLLVSLGLMAFAYFGPHLNRWEQLAYGFILAGAFGNGIDRFLFGYVVDFLD FRLINFPVFNLADVFINIGIICLLISTFPHKSRVP
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (LspA) and what is its role in bacterial systems?

Lipoprotein signal peptidase (LspA) is an aspartyl protease that performs a critical step in the bacterial lipoprotein processing pathway, specifically cleaving the transmembrane helix signal peptide of lipoproteins after they are lipidated by phosphatidylglycerol-prolipoprotein diacylglyceryl transferase (Lgt) . This processing is essential for proper lipoprotein maturation and function. LspA is universally found across the bacterial phylogenetic tree and is essential in many organisms including E. coli, S. enterica, and M. tuberculosis, while having no mammalian homologs . The processed lipoproteins perform various cellular functions including signal transduction, stress sensing, virulence, cell division, nutrient uptake, and adhesion .

How does Microcystis aeruginosa LspA compare structurally to other bacterial LspA proteins?

While detailed structural information specific to Microcystis aeruginosa LspA is limited in current literature, comparative analysis can be performed based on known structures of LspA from other bacterial species. The LspA enzyme typically contains highly conserved functional domains and catalytic residues across bacterial species, including a catalytic dyad and approximately 14 additional highly conserved residues surrounding the active site . When working with recombinant M. aeruginosa LspA, researchers should anticipate structural similarities to other gram-negative bacterial LspA proteins, particularly in the catalytic domains, while accounting for possible species-specific variations that might affect substrate specificity or inhibitor binding.

What expression systems are recommended for producing recombinant M. aeruginosa LspA?

For expressing recombinant M. aeruginosa LspA, E. coli-based expression systems with vectors containing inducible promoters (such as lac or trc promoters) have been successfully used for other bacterial LspA proteins . Based on previous studies with Rickettsia typhi LspA, cloning the full-length LspA gene into vectors like pTrcHisA with an N-terminal His₆ tag allows for controlled expression and subsequent purification . When designing the expression construct, it is advisable to maintain the entire open reading frame (ORF) of the LspA gene to ensure proper protein folding and function. The expressed protein can be detected using anti-His tag antibodies through Western blot analysis .

What are effective methods for assessing the functional activity of recombinant M. aeruginosa LspA?

Two principal methods have proven effective for assessing LspA functional activity:

  • Globomycin Resistance Assay: This assay leverages the fact that globomycin, a cyclic peptide antibiotic, specifically inhibits SPase II activity by acting as a substrate analog of the signal sequence . Overexpression of functional LspA in E. coli confers increased resistance to globomycin. In this assay:

    • Transform E. coli with a plasmid expressing M. aeruginosa LspA

    • Culture the transformed cells in media containing increasing concentrations of globomycin (typically 12.5-200 μg/ml)

    • Measure bacterial growth and compare to control cells containing an empty vector

    • Statistically significant growth at higher globomycin concentrations indicates functional LspA activity

  • Genetic Complementation: Using a temperature-sensitive E. coli strain (such as Y815) with a defective LspA gene:

    • Transform the temperature-sensitive strain with a plasmid expressing M. aeruginosa LspA

    • Culture at both permissive (30°C) and non-permissive (42°C) temperatures

    • Measure growth restoration at the non-permissive temperature

    • Successful complementation indicates functional LspA enzyme

How can I optimize purification protocols for recombinant M. aeruginosa LspA?

Purification of recombinant M. aeruginosa LspA presents challenges due to its membrane-associated nature. A systematic approach should include:

  • Expression optimization:

    • Test multiple induction conditions (IPTG concentration, temperature, duration)

    • Consider using specialized E. coli strains designed for membrane protein expression

  • Membrane protein extraction:

    • Use gentle detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG)

    • Optimize detergent concentration to maintain protein stability while achieving efficient extraction

  • Affinity purification:

    • For His-tagged constructs, use immobilized metal affinity chromatography (IMAC)

    • Include low concentrations of detergent in all purification buffers

    • Consider a stepwise imidazole gradient for elution to increase purity

  • Quality assessment:

    • Verify purity using SDS-PAGE (expect >90% purity as standard for research applications)

    • Confirm identity by western blotting and/or mass spectrometry

    • Assess aggregation state using size exclusion chromatography

How does the conformational dynamics of LspA affect its function, and how can these dynamics be studied in M. aeruginosa LspA?

LspA exhibits complex conformational dynamics critical to its function. Based on studies of other bacterial LspA proteins, the enzyme fluctuates between multiple conformational states that facilitate substrate binding and catalysis . The periplasmic helix of LspA fluctuates on the nanosecond timescale, sampling different conformations in apo and inhibitor-bound states .

To study these dynamics in M. aeruginosa LspA, researchers can employ:

  • Molecular Dynamics (MD) Simulations:

    • Create a homology model of M. aeruginosa LspA based on known structures

    • Perform all-atom MD simulations in a lipid bilayer environment

    • Analyze conformational changes, particularly in the periplasmic helix and active site regions

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Introduce site-directed spin labels at strategic positions

    • Perform continuous wave (CW) EPR to assess mobility

    • Use Double Electron-Electron Resonance (DEER) to measure distances between labeled sites

  • Comparative analysis of conformational states:

    • Analyze the enzyme in apo state versus inhibitor-bound states

    • Identify closed (active site occluded from membrane), intermediate, and open conformations

    • Correlate conformational changes with functional states

Current research indicates that in the apo state, LspA predominantly adopts a closed conformation that occludes the charged active site from the lipid bilayer, while inhibitor binding promotes a more open conformation . These conformational changes are crucial for understanding substrate recognition and designing effective inhibitors.

What experimental approaches can be used to identify potential inhibitors of M. aeruginosa LspA?

Identifying inhibitors of M. aeruginosa LspA requires a multifaceted approach:

  • Structure-based virtual screening:

    • Develop a homology model based on known LspA structures

    • Perform in silico docking of compound libraries

    • Select compounds with favorable binding energies to the active site

  • Biochemical assays:

    • Develop a fluorescence-based assay using synthetic peptide substrates

    • Measure enzymatic activity in the presence of potential inhibitors

    • Determine IC₅₀ values for promising compounds

  • Bacterial growth inhibition assays:

    • Test compounds for growth inhibition of M. aeruginosa

    • Compare with effects on LspA knockout or overexpression strains

    • Assess specificity by testing against other bacterial species

  • Binding studies:

    • Use isothermal titration calorimetry (ITC) to measure binding affinities

    • Perform thermal shift assays to evaluate compound-induced stability changes

    • Consider crystallography or cryo-EM to determine inhibitor-bound structures

Known inhibitors such as globomycin and myxovirescin can serve as positive controls and structural templates for developing new inhibitors . These compounds act as substrate analogs, binding to LspA and preventing prolipoprotein processing.

How does the genetic expression pattern of M. aeruginosa lspA compare to other lipoprotein processing genes?

For researchers studying M. aeruginosa lspA expression, a similar comparative approach is recommended:

  • Design qRT-PCR primers specific to M. aeruginosa lspA, lgt, and lepB

  • Monitor expression at different growth phases and under various environmental conditions

  • Analyze the correlation between expression patterns and physiological states

Expected expression patterns based on R. typhi data might include:

  • Higher expression during active growth phases

  • Coordinated expression with other lipoprotein processing genes

  • Potentially different regulation compared to general secretory pathway genes

What is the predicted substrate specificity of M. aeruginosa LspA, and how can it be experimentally determined?

Predicting and determining the substrate specificity of M. aeruginosa LspA requires both computational and experimental approaches:

Computational prediction:

  • Analyze the M. aeruginosa genome using specialized algorithms like SignalP and LipoP

  • Identify putative lipoproteins with characteristic signal peptide features

  • Compare the predicted lipobox motifs with those from well-characterized bacterial species

Experimental determination:

  • Generate a library of synthetic peptide substrates with variations in the lipobox region

  • Measure cleavage efficiency using purified recombinant LspA

  • Use mass spectrometry to confirm cleavage sites

  • Perform mutagenesis of putative recognition sites to validate their importance

Based on studies in other bacteria, approximately 1-3% of the bacterial proteome consists of lipoproteins . In R. typhi, for instance, 14 putative lipoproteins were identified among 89 predicted secretory proteins . Researchers should analyze the M. aeruginosa genome similarly to establish a baseline prediction of potential substrates.

What are common challenges in working with recombinant M. aeruginosa LspA and how can they be addressed?

Researchers working with recombinant M. aeruginosa LspA may encounter several technical challenges:

ChallengePotential SolutionImplementation Details
Low expression levelsOptimize codon usageAdapt codons to match expression host preferences; consider synthetic gene synthesis
Protein insolubilityModify expression conditionsReduce induction temperature (16-20°C); use lower inducer concentrations; test different detergents
Improper membrane insertionUse specialized expression hostsE. coli C41(DE3) or C43(DE3) strains designed for membrane protein expression
Loss of activity during purificationAdjust purification conditionsMaintain detergent above critical micelle concentration; include lipids in purification buffers
Protein aggregationScreen stabilizing additivesTest glycerol (10-20%), specific lipids, and mild reducing agents
Difficulty in functional assaysDevelop alternative activity assaysConsider fluorescence-based assays with synthetic peptide substrates

How can researchers effectively study the interaction between M. aeruginosa LspA and potential inhibitors?

Studying LspA-inhibitor interactions requires multiple complementary approaches:

  • Binding affinity determination:

    • Surface Plasmon Resonance (SPR) to measure real-time binding kinetics

    • Microscale Thermophoresis (MST) for solution-based affinity measurements

    • Isothermal Titration Calorimetry (ITC) to determine thermodynamic parameters

  • Structural studies:

    • X-ray crystallography of inhibitor-bound LspA (challenging but informative)

    • Cryo-electron microscopy for structure determination without crystallization

    • Hydrogen/Deuterium Exchange Mass Spectrometry (HDX-MS) to map binding interfaces

  • Molecular modeling:

    • Molecular dynamics simulations of inhibitor binding

    • Free energy calculations to estimate binding strength

    • Identification of key interaction residues for mutagenesis validation

  • Functional validation:

    • Enzyme inhibition assays with purified recombinant LspA

    • Growth inhibition assays in bacterial cultures

    • Resistance development studies to assess barrier to resistance

Known LspA inhibitors like globomycin act by mimicking the substrate and binding to the active site . Comparison of inhibitor binding modes between different bacterial LspA enzymes can provide insights into conserved mechanisms and species-specific differences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.