Recombinant Microcystis aeruginosa NAD (P)H-quinone oxidoreductase subunit 3

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhC; MAE_11760; NAD(PH-quinone oxidoreductase subunit 3; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3; NDH-1 subunit 3; NDH-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Microcystis aeruginosa (strain NIES-843)
Target Names
ndhC
Target Protein Sequence
MFVLKGYEYFLGFLLACSLVPILSLTASKVLRPSGGGPERRTTYESGMEPIGGAWIQFNI RYYMFALVFVVFDVETVFLYPWAVAFNQLGLLAFVEALIFIAILVVALVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH-1 (NAD(P)H-quinone oxidoreductase subunit 3) facilitates electron transfer from an unidentified electron donor, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory and/or photosynthetic chain. In this organism, plastoquinone is considered the primary electron acceptor. This redox reaction is coupled to proton translocation, conserving redox energy as a proton gradient. In cyanobacteria, NDH-1 also contributes to inorganic carbon concentration.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic function of NAD(P)H-quinone oxidoreductase in Microcystis aeruginosa?

NAD(P)H-quinone oxidoreductase in Microcystis aeruginosa functions as a catalytic enzyme that mediates electron transfer from NAD(P)H to quinones. Similar to other cyanobacterial NDH-1 complexes, this enzyme:

  • Catalyzes the two-electron reduction of quinones to their hydroquinone forms

  • Contributes to cellular redox balance

  • May participate in detoxification pathways

  • Likely plays a role in respiratory electron transport

Researchers investigating this enzyme should use assays measuring electron transfer from NADPH or NADH to appropriate quinone substrates. Based on homologous enzymes, it's recommended to start with plastoquinone as a substrate and monitor activity spectrophotometrically at 340 nm to track NAD(P)H oxidation .

How does the structure of NAD(P)H-quinone oxidoreductase contribute to its catalytic mechanism?

While the specific structure of Microcystis aeruginosa NAD(P)H-quinone oxidoreductase subunit 3 has not been fully resolved, insights can be drawn from homologous proteins. Similar quinone oxidoreductases exhibit:

  • A bi-modular architecture with distinct NADPH-binding and substrate-binding domains

  • A catalytic site containing conserved cysteine residues (often Cys-147) that play key roles in electron transfer

  • Formation of oligomeric structures (often homodimers) in physiological conditions

To investigate structure-function relationships, researchers should consider:

  • Utilizing homology modeling based on crystallized oxidoreductases

  • Performing site-directed mutagenesis of predicted key residues

  • Conducting substrate docking simulations to predict binding modes

What are the optimal expression conditions for recombinant Microcystis aeruginosa NAD(P)H-quinone oxidoreductase?

The optimal expression of this recombinant protein requires careful consideration of several parameters:

Expression System:

  • E. coli is the preferred heterologous host for expression

  • BL21(DE3) or Rosetta strains show better expression for cyanobacterial proteins

Induction Conditions:

  • IPTG concentration: 0.1-0.5 mM

  • Temperature: Lowering to 16-20°C after induction often improves solubility

  • Duration: Extended expression (16-24 hours) at lower temperatures yields better results

Buffer Optimization:

  • Include glycerol (20-50%) in storage buffers to maintain stability

  • Tris-based buffers (pH 7.5-8.0) are recommended

  • Addition of reducing agents (DTT or β-mercaptoethanol) helps maintain enzymatic activity

What role might NAD(P)H-quinone oxidoreductase play in microcystin production or detoxification?

NAD(P)H-quinone oxidoreductase may significantly influence microcystin dynamics through several potential mechanisms:

Proposed Relationships:

Research approaches should include:

  • Gene knockout/knockdown studies

  • Metabolic flux analysis

  • Correlation of enzyme activity with microcystin production under various stressors

What assay systems provide the most reliable measurements of NAD(P)H-quinone oxidoreductase activity?

Reliable measurement of NAD(P)H-quinone oxidoreductase activity requires careful selection of appropriate assay systems:

Spectrophotometric Assays:

  • Direct monitoring of NAD(P)H oxidation at 340 nm (ε = 6,220 M⁻¹cm⁻¹)

  • Recommended quinone substrates: 1,4-benzoquinone, plastoquinone, or 9,10-phenanthrenequinone

  • Control reactions should include enzyme-free and substrate-free samples

Discontinuous HPLC Analysis:

  • Separating and quantifying quinone and hydroquinone forms

  • Allows determination of product formation directly

  • Essential for confirming two-electron versus one-electron reduction pathways

Oxygen Consumption Assays:

  • Measuring oxygen uptake during redox cycling

  • Clark-type oxygen electrodes provide real-time monitoring

  • Important for distinguishing between direct two-electron reduction and redox cycling

Recommended Reaction Conditions:

ComponentConcentrationNotes
Phosphate buffer50-100 mM (pH 7.5)Maintain pH stability
NAD(P)H50-200 μMSubstrate concentration above Km
Quinone10-100 μMVaries by substrate type
Enzyme0.1-1.0 μg/mlAdjusted for linear reaction rates
Temperature25-30°CStandardized for reproducibility

For complex samples, selective inhibitors can help distinguish NQO activity from other quinone reductases .

How does NAD(P)H-quinone oxidoreductase activity correlate with Microcystis bloom dynamics?

The relationship between NAD(P)H-quinone oxidoreductase activity and Microcystis bloom dynamics reveals important ecological insights:

Environmental Factors Influencing Enzyme Activity:

  • Nitrogen availability: Urea addition upregulates photosynthesis machinery and metabolic pathways

  • Oxidative stress: Solar radiation and temperature fluctuations affect redox balance

  • Bloom stage: Enzyme expression patterns shift during bloom progression

Research Findings:

  • Transcriptomic studies show NAD(P)H-quinone oxidoreductase upregulation coincides with bloom persistence

  • The enzyme may help manage oxidative stress during high-density bloom conditions

  • Activity patterns suggest a sequence where nutritional requirements are fulfilled before energy is invested in toxin production

Methodological Approaches for Field Studies:

  • Collect samples at different bloom stages

  • Measure enzyme activity in conjunction with environmental parameters

  • Correlate with bloom intensity and toxin levels

  • Use transcriptomic analysis to track gene expression patterns throughout bloom cycles

How does oxidative stress affect NAD(P)H-quinone oxidoreductase expression and function in Microcystis?

Oxidative stress significantly impacts NAD(P)H-quinone oxidoreductase expression and function in Microcystis through several mechanisms:

Response Patterns:

  • Increased superoxide dismutase (SOD) activity correlates with oxidative stress conditions

  • Malondialdehyde (MDA) levels indicate membrane damage from oxidative stress

  • NAD(P)H-quinone oxidoreductase may serve as part of the cellular defense system

Experimental Evidence:
Studies exposing Microcystis to copper sulfate (a common bloom control agent) revealed:

  • Species-dependent variation in sensitivity to oxidative stressors

  • SOD activity increased with exposure to Microcystis exudates

  • Differential tissue damage patterns indicated by varying MDA concentrations

Experimental Design Considerations:

  • Use multiple oxidative stress markers (SOD, MDA, GSH levels)

  • Employ gene expression analysis to track transcriptional responses

  • Monitor both short-term (acute) and long-term (adaptive) responses

These findings suggest NAD(P)H-quinone oxidoreductase participates in a complex redox management system that varies among Microcystis species and strains, potentially explaining differences in bloom resilience .

Can NAD(P)H-quinone oxidoreductase be targeted for bloom control strategies?

NAD(P)H-quinone oxidoreductase presents a potential target for bloom control strategies through several approaches:

Potential Intervention Strategies:

  • Enzyme Inhibition Approach:

    • Identify specific inhibitors of cyanobacterial NAD(P)H-quinone oxidoreductase

    • Design compounds targeting unique structural features not present in eukaryotic homologs

    • Develop delivery systems for field application with minimal ecological impact

  • Metabolic Disruption Strategy:

    • Target redox balance mechanisms to create oxidative stress

    • Combine with nutrient management to stress cyanobacterial populations

    • Integrate with existing bloom control technologies

  • Biological Control Development:

    • Engineer microorganisms expressing recombinant enzymes that interfere with quinone metabolism

    • Develop systems similar to recombinant Saccharomyces cerevisiae expressing microcystin-degrading enzymes

    • Optimize for environmental application and safety

Current Research Progress:

  • Recombinant systems expressing microcystin-degrading enzymes have shown 83% toxin reduction

  • Understanding of structural features enables rational design of inhibitors

  • Quinone metabolism plays critical roles in bloom persistence and resilience

Research challenges include developing compounds with specificity for cyanobacterial enzymes while minimizing impacts on beneficial organisms in aquatic ecosystems .

How can researchers resolve contradictory findings regarding NAD(P)H-quinone oxidoreductase function?

Resolving contradictory findings about NAD(P)H-quinone oxidoreductase function requires systematic approaches:

Common Sources of Contradictions:

  • Species and strain variations among Microcystis

  • Different experimental conditions (pH, temperature, substrate concentrations)

  • Varying recombinant expression systems

  • Presence of multiple enzyme isoforms with overlapping activities

Resolution Strategies:

  • Meta-analysis approach: Systematically compare methodologies across studies to identify variables affecting outcomes

  • Standardized protocols: Develop consensus methods for enzyme assays and expression

  • Multi-technique validation: Confirm findings using orthogonal experimental approaches

Practical Steps:

Researchers should particularly note that pH-dependent effects have been observed in related quinone oxidoreductases, where catalytic mechanisms change significantly between acidic and basic conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.