Recombinant Microcystis aeruginosa Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Function and Role of Ycf4

Ycf4 functions as a nonessential assembly factor for Photosystem I in higher plants . It is involved in the early processes of PSI complex assembly . The protein is also thought to play a pivotal role in the initial assembly step of PSI by directly mediating the interactions between newly synthesized PSI polypeptides and in assisting the assembly of the PSI complex .

Ycf4 in Microcystis aeruginosa

Microcystis aeruginosa is a bloom-forming toxic cyanobacterium . In M. aeruginosa, complete sets of genes for both photosystem I (PSI) and photosystem II (PSII) are present . Studies have shown that electromagnetic radiation can alter the photosynthesis-related protein expression levels in M. aeruginosa, affecting the function of photosynthetic pigments, photosystem II potential activity, photosynthetic electron transport process, and photosynthetic phosphorylation process .

Mutational Analysis of Ycf4

Mutational analysis in Chlamydomonas reinhardtii has provided insights into the function of Ycf4 .

  • Single mutants R120A and R120Q accumulated less Ycf4 but assembled a functional PSI complex .

  • Single mutants E179A, E179Q, and E181Q assembled a functional PSI complex like the wild type, whereas the single mutant E181A and double mutant E179/181A accumulated a functional PSI complex to significantly reduced levels .

  • The double mutant E179/181Q did not assemble any mature PSI complex, suggesting that the two glutamic acid residues play crucial roles in the functionality of Ycf4 .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this is provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
ycf4; MAE_44810; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Microcystis aeruginosa (strain NIES-843)
Target Names
ycf4
Target Protein Sequence
MKAQTTSKDSLILRQEVVGARRPSNYFWAVIVSIGGLGFLLAGLSSYLKVNLLLVSDTSA LQFIPQGVALLFYGTAGTLLAIYLWLSLLWNVGGGYNEFNKETGKVKIFRWGYPGKNRRI DLDWPLEDAQAVRAEVREGLNPKRELFLRIKQRRDIPLTRVGDPMSLSELENQGAELARF LEIPLEGL
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Database Links
Protein Families
Ycf4 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Ycf4 in photosynthetic organisms?

Ycf4 (hypothetical open reading frame 4) is a thylakoid protein essential for the assembly and accumulation of photosystem I (PSI) in photosynthetic organisms. Recent research has revealed that Ycf4 acts as a scaffold for PSI assembly, with evidence showing that Ycf4-containing complexes associate with newly synthesized PSI polypeptides that are partially assembled as pigment-containing subcomplexes .

In cyanobacteria and algae like Chlamydomonas reinhardtii, Ycf4-deficient mutants are unable to develop photoautotrophically and cannot accumulate PSI . Although earlier research with partial knockouts suggested Ycf4 might be non-essential in some plants, comprehensive studies with complete gene deletion have demonstrated its critical importance for photosynthetic function .

How can researchers effectively express and purify recombinant Ycf4 for functional studies?

For effective expression and purification of recombinant Ycf4:

  • Expression system selection: The E. coli expression system is commonly used for recombinant Ycf4 production, as demonstrated in studies with the full-length Ycf4 protein (1-184 amino acids) from various species .

  • Fusion tag approach: Incorporating tags such as His-tag at the N-terminal region facilitates purification via affinity chromatography . For more complex studies, tandem affinity purification (TAP) tags can be employed, consisting of calmodulin binding peptide and Protein A domains separated by a tobacco etch virus protease cleavage site .

  • Purification protocol:

    • Solubilize thylakoid membranes with appropriate detergents (e.g., DDM)

    • Apply extracts to affinity columns (IgG agarose for TAP-tagged proteins)

    • For optimized adsorption, incubate extracts with IgG agarose at 4°C overnight

    • Elute bound proteins and confirm purity via SDS-PAGE

  • Storage conditions: Store purified Ycf4 at -20°C/-80°C in buffer containing 6% trehalose at pH 8.0, with 50% glycerol added for long-term storage. Avoid repeated freeze-thaw cycles .

How do researchers explain the contradictory findings regarding Ycf4 essentiality in different organisms?

The contradictory findings regarding Ycf4 essentiality stem from several factors:

C-terminal domain significance:
In-silico protein-protein interaction studies reveal that the C-terminus (91 amino acids) of Ycf4 plays a crucial role in interactions with other chloroplast proteins. When the C-terminal domain remains intact (as in partial knockouts), some functionality is preserved .

Species-specific variation:
Evolutionary differences exist across photosynthetic organisms:

  • In Chlamydomonas reinhardtii, Ycf4 is absolutely essential for PSI accumulation

  • In cyanobacterium Synechocystis, mutants can maintain some PSI assembly at reduced levels

  • In higher plants, the degree of dependence varies

Comparative analysis of Ycf4 essentiality across species:

OrganismComplete knockout phenotypePartial knockout phenotypePSI assembly impact
Tobacco (Nicotiana tabacum)Unable to survive photoautotrophicallyCan grow photoautotrophicallySevere reduction in complete knockouts
Chlamydomonas reinhardtiiUnable to develop photoautotrophicallyNot reportedNo PSI accumulation
SynechocystisGrowth possible but impairedNot reportedReduced PSI levels

What methodological approaches help resolve ultrastructural changes in chloroplasts lacking Ycf4?

Transmission electron microscopy (TEM) provides crucial insights into ultrastructural changes in chloroplasts lacking Ycf4. The methodological approach includes:

Sample preparation protocol:

  • Fix leaf tissue samples in glutaraldehyde (2.5-3%) in phosphate buffer

  • Post-fix with osmium tetroxide (1%)

  • Dehydrate through an ethanol series

  • Embed in epoxy resin

  • Cut ultrathin sections (60-90 nm) using ultramicrotome

  • Stain with uranyl acetate and lead citrate

Comparative analysis parameters:

  • Chloroplast size and shape

  • Thylakoid membrane organization and density

  • Grana stacking patterns

  • Presence of vesicular structures

  • Stromal content and organization

Observed differences in ΔYcf4 plants:
TEM studies of tobacco ΔYcf4 mutants revealed significant structural anomalies compared to wild-type plants:

  • Wild-type chloroplasts: Oblong shape, larger size

  • Knockout chloroplasts: Rounded shape, smaller size

  • Thylakoid membranes: Less organized with vesicular structures in mutants

  • Grana thylakoids: Less discrete with loss of orderly structure in mutants

These ultrastructural changes directly correlate with the photosynthetic incompetence observed in ΔYcf4 plants.

How can transcriptome analysis elucidate Ycf4's regulatory functions beyond PSI assembly?

Transcriptome analysis has revealed unexpected functions of Ycf4 beyond its role in PSI assembly:

Methodological approach:

  • Generate homoplasmic Ycf4 knockout plants (ΔYcf4)

  • Extract total RNA from wild-type and ΔYcf4 plants

  • Prepare cDNA libraries for RNA sequencing

  • Perform differential gene expression analysis

  • Validate key findings with RT-qPCR

Key transcriptional changes in ΔYcf4 plants:

Gene categoryExpression change in ΔYcf4Functional implication
PSI genesUnchangedYcf4 not required for PSI gene expression
PSII genesUnchangedYcf4 not involved in PSII gene regulation
Ribosomal genesUnchangedYcf4 not affecting general translation
rbcL (RuBisCO large subunit)DecreasedYcf4 potentially regulating carbon fixation
LHC (Light-Harvesting Complex)DecreasedYcf4 influencing light capture efficiency
ATP Synthase (atpB, atpL)DecreasedYcf4 affecting energy production

These transcriptional changes suggest Ycf4 has additional regulatory functions in coordinating photosynthesis beyond its structural role in PSI assembly. The protein may serve as an integrator of signals that optimize photosynthetic complex stoichiometry in response to environmental conditions .

What are the physiological consequences of Ycf4 deletion in photosynthetic organisms?

Complete deletion of Ycf4 results in profound physiological impairments:

Heterotrophic phenotype:

  • Inability to grow without external carbon source

  • Growth inhibition on media with sucrose concentrations below 10 mg/L

  • Limited growth even at higher sucrose concentrations (15-30 mg/L)

  • Complete failure to grow photoautotrophically in soil

Chlorophyll content reduction:

  • Young leaves in ΔYcf4 plants: 2.6 mg/g (vs. 3.1 mg/g in wild-type)

  • Mature leaves: Up to 99.98% reduction in chlorophyll

Photosynthetic parameter changes:

ParameterWild-typeΔYcf4 mutant% Change
Photosynthetic rate (A)NormalSeverely decreased>80% reduction
Transpiration rate (E)NormalDecreasedSignificant reduction
Stomatal conductance (gs)NormalDecreasedSignificant reduction
Sub-stomatal CO₂ (Ci)NormalAlteredSignificant change
Photosynthetic photon flux density (q)NormalDecreasedSignificant reduction

These physiological defects appear more severe than previously reported in partial Ycf4 knockouts, highlighting the critical nature of the complete protein, particularly its C-terminal domain, for photosynthetic function .

How might CRISPR-Cas systems be utilized for functional studies of Ycf4 in Microcystis aeruginosa?

CRISPR-Cas systems offer powerful approaches for studying Ycf4 function in Microcystis aeruginosa:

System selection considerations:
M. aeruginosa FACHB-524 contains multiple CRISPR-Cas systems, including two type I (I-B1, I-D) and three type III-B systems . For Ycf4 studies, researchers should consider:

  • Type III-B systems advantages:

    • Demonstrated anti-phage activity when expressed heterologously

    • Enhanced immune activity with accessory proteins like Csx1

    • Successful expression in E. coli for functional studies

Implementation strategy:

  • Target design:

    • Design sgRNAs targeting different regions of the Ycf4 gene

    • Create libraries targeting both N-terminal and C-terminal regions

    • Include controls targeting non-essential regions

  • Expression system:

    • Clone native M. aeruginosa CRISPR system components

    • Express in either native host or heterologous system (E. coli)

    • Purify Cmr-crRNA effector complexes for in vitro studies

  • Mutant characterization:

    • Generate full and partial Ycf4 knockouts

    • Compare phenotypic differences between N-terminal and C-terminal deletions

    • Analyze PSI assembly, photosynthetic performance, and growth characteristics

This approach would allow precise dissection of Ycf4 domain functions in M. aeruginosa and facilitate comparative studies with Ycf4 proteins from other photosynthetic organisms.

What are the optimal conditions for heterologous expression of Microcystis aeruginosa Ycf4?

For optimal heterologous expression of M. aeruginosa Ycf4:

Expression system selection:
The E. coli BL21(DE3) strain has proven effective for expression of cyanobacterial proteins, including CRISPR-Cas system components from M. aeruginosa .

Vector considerations:

  • Use vectors with strong, inducible promoters (e.g., T7)

  • Include appropriate fusion tags (His, TAP) for purification

  • Consider codon optimization for E. coli expression

Culture conditions:

  • Grow cultures at 37°C until OD₆₀₀ reaches 0.6-0.8

  • Induce protein expression with IPTG (0.5-1.0 mM)

  • Continue incubation at lower temperature (16-25°C) for 16-20 hours

  • Harvest cells by centrifugation (5,000 × g, 10 minutes, 4°C)

Protein extraction:
For membrane proteins like Ycf4:

  • Resuspend cell pellet in lysis buffer with protease inhibitors

  • Disrupt cells using sonication or French press

  • Separate membrane fraction by ultracentrifugation

  • Solubilize membrane proteins with appropriate detergents (DDM, β-OG)

Purification strategy:
Follow affinity purification protocols based on the incorporated tag, with special consideration for maintaining the integrity of membrane protein structure during purification .

How can researchers accurately measure and quantify Ycf4-mediated PSI assembly efficiency?

Quantifying Ycf4-mediated PSI assembly requires multi-faceted approaches:

Pulse-chase protein labeling:

  • Pulse cells with radiolabeled amino acids (³⁵S-methionine)

  • Chase with excess non-radioactive amino acids

  • Isolate thylakoid membranes at different time points

  • Immunoprecipitate Ycf4-containing complexes

  • Analyze associated PSI subunits by SDS-PAGE and autoradiography

This technique revealed that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as pigment-containing subcomplexes .

Spectroscopic analysis:

  • Measure P700 (PSI reaction center) content using differential absorption spectroscopy

  • Determine chlorophyll a/b ratios to assess PSI/PSII stoichiometry

  • Analyze low-temperature (77K) fluorescence emission spectra to evaluate PSI assembly states

Protein complex analysis:

  • Separate native protein complexes using blue native polyacrylamide gel electrophoresis (BN-PAGE)

  • Perform second-dimension SDS-PAGE to resolve complex components

  • Quantify PSI subunits using immunoblotting with specific antibodies

In vitro reconstitution assays:
Developing a reconstitution system using purified components to measure Ycf4-dependent PSI assembly rates under controlled conditions.

What protocols are recommended for analyzing Ycf4 protein-protein interactions in cyanobacteria?

Several complementary approaches are recommended:

Co-immunoprecipitation (Co-IP):

  • Solubilize thylakoid membranes with mild detergents

  • Incubate with antibodies against Ycf4 or suspected interaction partners

  • Capture complexes with Protein A/G beads

  • Wash extensively to remove non-specific interactions

  • Elute bound proteins and analyze by immunoblotting or mass spectrometry

Tandem Affinity Purification (TAP):
A powerful two-step affinity purification strategy:

  • Create TAP-tagged Ycf4 (calmodulin binding peptide + Protein A domains)

  • Express in cyanobacteria

  • Purify using IgG agarose column

  • Cleave with tobacco etch virus protease

  • Further purify using calmodulin affinity resin

  • Identify interacting partners by mass spectrometry

Sucrose gradient ultracentrifugation:
Particularly useful for large complexes like those formed by Ycf4:

  • Layer solubilized thylakoid extracts on 10-40% sucrose gradient

  • Centrifuge at 100,000 × g for 16-20 hours

  • Collect fractions and analyze by immunoblotting

  • Determine size of complexes using standards

This approach revealed the intimate association between Ycf4 and COP2 in Chlamydomonas reinhardtii .

Electron microscopy of purified complexes:
Provides structural insights into Ycf4-containing complexes:

  • Apply purified complexes to carbon-coated copper grids

  • Negative stain with uranyl acetate

  • Image using transmission electron microscopy

  • Perform single particle analysis for structural determination

This technique revealed that Ycf4-containing complexes measure approximately 285 × 185 Å .

How might Ycf4 research contribute to understanding harmful cyanobacterial blooms?

Understanding Ycf4's role in Microcystis aeruginosa could provide insights into harmful algal bloom (HAB) formation and management:

Photosynthetic efficiency connection:
Given Ycf4's essential role in PSI assembly, variations in Ycf4 structure or function could influence photosynthetic efficiency and thus bloom formation dynamics. Research could investigate:

  • Correlation between Ycf4 sequence variations and bloom-forming capacity

  • Impact of environmental factors on Ycf4 expression and PSI assembly

  • Potential targeting of Ycf4 function to control bloom formation

Bloom environmental dynamics:
M. aeruginosa blooms occur under specific environmental conditions:

  • Nutrient-rich, slowly moving water

  • Specific temperature ranges

  • Light availability parameters

Research could explore how these conditions affect Ycf4 expression and function, potentially revealing new intervention points for bloom control.

  • Correlation between Ycf4 function, PSI efficiency, and microcystin production

  • Potential metabolic links between photosynthesis and toxin synthesis pathways

  • Temporal relationship between PSI assembly and toxin production during bloom development

Understanding these connections could contribute to more effective bloom prediction and management strategies.

What evolutionary insights can be gained from studying Ycf4 sequence divergence across photosynthetic organisms?

Evolutionary analysis of Ycf4 reveals fascinating patterns of sequence divergence:

Accelerated evolution in certain lineages:

  • Legumes show dramatically accelerated Ycf4 evolution compared to other angiosperms

  • Within legumes, genera like Lathyrus and Desmodium exhibit extremely rapid evolution

  • In some species, Ycf4 has been completely lost (gene loss in three Desmodium species)

Sequence conservation paradox:
Despite functional importance, Ycf4 shows remarkable sequence divergence:

Size expansion patterns:

  • Significant size expansion in certain lineages (up to 340 residues in some Lathyrus species compared to the typical ~184 residues)

  • Species-specific tandem repeats contributing to size expansion

  • High turnover rate of minisatellite-like sequences

These evolutionary patterns suggest Ycf4 represents an intriguing model for studying the balance between functional constraint and sequence plasticity in essential photosynthetic components.

How might understanding Ycf4 function contribute to engineering more efficient photosynthetic systems?

Understanding Ycf4's role in PSI assembly offers several avenues for photosynthetic engineering:

Optimizing PSI/PSII ratios:
Research has shown that Ycf4 deletion affects not only PSI assembly but also expression of genes related to light-harvesting complexes and ATP synthase . Engineering Ycf4 expression levels or activity could potentially:

  • Optimize photosystem stoichiometry for different light conditions

  • Enhance electron transport efficiency

  • Improve ATP production for carbon fixation

Engineering stress tolerance:
Ycf4's critical role in maintaining functional chloroplast ultrastructure suggests that modifying its expression or activity could enhance photosynthetic resilience under stress conditions, potentially:

  • Improving heat tolerance through stabilized PSI assembly

  • Enhancing recovery after photoinhibition

  • Maintaining photosynthetic efficiency under fluctuating light conditions

Cross-species optimization:
The significant variation in Ycf4 sequence and size across species, despite maintained functionality , suggests potential for:

  • Identifying naturally optimized Ycf4 variants from highly efficient photosynthetic organisms

  • Creating chimeric Ycf4 proteins combining domains with enhanced properties

  • Transplanting complete Ycf4 systems between species to enhance photosynthetic performance

These approaches could contribute to developing crops with enhanced photosynthetic efficiency and environmental resilience.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.