Recombinant Microcystis aeruginosa Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psaL; MAE_43690; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Microcystis aeruginosa (strain NIES-843)
Target Names
psaL
Target Protein Sequence
MAETGYKQVVTPYNDDPFIGHLATPISASGFTKAFIGNLPAYRPGLAPILRGLEVGMAHG YFLGGPWVVLGPLRDSEYANIGGLIPALAMVLLATGCLASYGLVSFQGKAASNDPLKSAE GWSQFAAGFFIGGMGGAFVAYFLLENLGVVDGIMRGVFNQ
Uniprot No.

Target Background

Database Links
Protein Families
PsaL family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of PsaL in Microcystis aeruginosa?

PsaL serves as a critical subunit in the Photosystem I (PSI) complex of Microcystis aeruginosa, playing an essential role in energy transfer within the photosynthetic apparatus. Research has demonstrated that PsaL is specifically critical for energy transfer from phosphorylated light-harvesting complex II (LHCII) to the PSI reaction center . This function is vital for the photosynthetic efficiency of M. aeruginosa, as it facilitates the capture and utilization of light energy that drives electron transport and subsequent energy production.

The functional significance of PsaL extends beyond simple energy transfer, as it contributes to the structural organization of the PSI complex. In cyanobacteria like M. aeruginosa, PsaL helps maintain the integrity of the photosynthetic machinery, ensuring proper electron flow from plastocyanin to ferredoxin, which are important PSI turnover products involved in electron transfer induced by light energy .

What methods are commonly used to express recombinant PsaL from Microcystis aeruginosa?

Expression of recombinant PsaL typically employs molecular cloning techniques where the psaL gene from M. aeruginosa is isolated, amplified using PCR, and inserted into an appropriate expression vector. The methodology often includes:

  • Gene isolation and amplification: Using primers designed based on the psaL gene sequence from M. aeruginosa (such as the PCC 7806SL strain) .

  • Vector construction: Cloning the amplified gene into an expression vector containing an appropriate promoter and selection marker.

  • Transformation: Introducing the recombinant vector into a suitable host organism, commonly E. coli strains optimized for protein expression.

  • Expression induction: Using chemical inducers such as IPTG to activate expression of the recombinant protein.

  • Protein purification: Isolating the recombinant PsaL using affinity chromatography, typically with a histidine tag system.

Verification of successful expression typically employs quantitative PCR (qPCR) techniques similar to those used in transcriptional analysis studies, with 16S rRNA as a reference gene for normalization .

How can researchers effectively measure PsaL expression changes in response to environmental stressors?

Measuring PsaL expression changes requires a multi-faceted approach combining molecular and physiological techniques:

  • Transcriptional analysis: RNA extraction followed by quantitative reverse transcription PCR (RT-qPCR) using gene-specific primers for psaL, with normalization against reference genes like 16S rRNA. This approach allows for measurement of relative transcript abundance under different conditions .

  • RNA sequencing (RNA-seq): For genome-wide expression analysis, next-generation sequencing can be employed to quantify psaL expression in the context of the entire transcriptome. This enables identification of co-regulated genes and potential regulatory networks .

  • Experimental conditions: When designing experiments to measure stress responses, researchers should:

    • Establish clear control and treatment groups

    • Carefully monitor physiological parameters such as chlorophyll concentration

    • Measure photosynthetic efficiency using PAM fluorometry

    • Track growth rates and cell density over defined time points

For validation of RNA-seq results, targeted qRT-PCR should be performed, ensuring that the expression trends observed with both methods are consistent, even if the fold changes differ in magnitude .

What are the key considerations when designing experiments to study PsaL function in photosynthetic efficiency?

When designing experiments to study PsaL function in photosynthetic efficiency, researchers should consider:

  • Knockout or knockdown approaches: Generate psaL-deficient mutants to assess the direct impact on photosynthetic activity. This can be achieved through:

    • Targeted gene disruption

    • RNA interference

    • CRISPR-Cas9 gene editing

  • Complementation studies: Reintroduce wild-type or modified psaL genes to confirm phenotypic restoration, thereby validating the specific role of PsaL.

  • Physiological measurements:

    • Oxygen evolution rates to quantify photosynthetic output

    • Chlorophyll fluorescence to assess PSII and PSI functionality

    • P700 redox kinetics to specifically evaluate PSI electron transfer

  • Structural analysis: Characterize any changes in PSI organization resulting from PsaL modification using techniques such as:

    • Blue-native gel electrophoresis to assess complex integrity

    • Electron microscopy to visualize structural alterations

    • Mass spectrometry to identify interaction partners

  • Environmental variables: Test function under different light intensities, spectral qualities, and nutrient conditions to comprehensively understand PsaL's role in various ecological scenarios.

How can contradictions in experimental data regarding PsaL function be effectively analyzed and resolved?

When faced with contradictory results regarding PsaL function, researchers should implement a structured approach to analysis and resolution:

What are the current techniques for investigating post-translational modifications of PsaL and their impact on function?

Investigation of post-translational modifications (PTMs) of PsaL requires specialized techniques:

  • Phosphorylation analysis: Recent research has shown light-dependent phosphorylation of various PSI subunits, with potential consequences for PSI complex formation . For PsaL:

    • Phosphoproteomic analysis using LC-MS/MS can identify specific phosphorylation sites

    • Phospho-specific antibodies can be developed for immunodetection

    • Mutagenesis of potential phosphorylation sites (serine, threonine, tyrosine residues) can determine functional significance

  • Other PTM detection:

    • Glycosylation can be assessed using periodic acid-Schiff staining or lectin blotting

    • Ubiquitination can be detected with specific antibodies or tandem ubiquitin binding entities

    • Acetylation can be analyzed through immunoprecipitation with acetyl-lysine antibodies followed by mass spectrometry

  • Functional correlation:

    • Site-directed mutagenesis of modified residues to mimic or prevent modification

    • In vitro reconstitution assays with modified and unmodified proteins

    • Structural studies to determine how PTMs affect protein-protein interactions within the PSI complex

  • Temporal dynamics:

    • Time-course experiments to track modification patterns during different physiological states

    • Correlation with environmental stressors and photosynthetic activity

How does the recombinant expression system affect the structural and functional properties of PsaL compared to native protein?

The choice of expression system can significantly impact the properties of recombinant PsaL:

  • Structural differences:

    • Prokaryotic expression systems (E. coli) may lack the machinery for proper folding of cyanobacterial proteins

    • Eukaryotic systems may introduce non-native post-translational modifications

    • Membrane protein expression often requires specialized systems that maintain the hydrophobic environment

  • Comparative analysis approaches:

    • Circular dichroism spectroscopy to compare secondary structure profiles

    • Limited proteolysis to assess structural accessibility differences

    • Intrinsic fluorescence spectroscopy to evaluate tertiary structure

    • Thermal shift assays to compare stability profiles

  • Functional assessment:

    • Reconstitution experiments with isolated PSI complexes lacking PsaL

    • Energy transfer efficiency measurements using time-resolved fluorescence

    • Electron transfer kinetics using flash photolysis

  • Optimization strategies:

    • Use of specialized expression hosts (e.g., cyanobacterial systems)

    • Codon optimization for the expression host

    • Fusion with solubility tags that can be later removed

    • Expression of truncated functional domains when full-length protein is problematic

What is the relationship between PsaL structure/function and microcystin production in toxic strains of M. aeruginosa?

The relationship between PsaL and microcystin production represents an intriguing area for investigation:

  • Correlation analysis:

    • Compare psaL expression patterns between toxic and non-toxic strains

    • Analyze whether environmental factors that induce microcystin production also affect PsaL expression

    • Investigate whether microcystin biosynthesis and photosynthetic efficiency are metabolically linked

  • Mechanistic investigations:

    • Test whether disruptions in psaL affect microcystin biosynthesis gene expression

    • Determine if alterations in photosynthetic electron flow (regulated by PsaL) impact precursor availability for microcystin synthesis

    • Examine whether microcystins can directly interact with PsaL or the PSI complex

  • Physiological context:

    • Microcystins are known liver toxins that can cause severe damage, including death within hours following exposure

    • Understanding the relationship between photosynthesis regulation and toxin production could provide insights into bloom toxicity prediction

    • Both microcystin production and photosynthesis respond to environmental stressors, suggesting potential regulatory overlap

  • Experimental approaches:

    • Gene knockout studies comparing microcystin production in wild-type and psaL mutants

    • Metabolic flux analysis to track carbon flow between photosynthesis and toxin production

    • Transcriptomic and proteomic profiling to identify co-regulated pathways

What are the most effective protocols for purifying recombinant PsaL while maintaining its native conformation?

Purification of recombinant PsaL with preserved native conformation requires careful consideration of its membrane protein characteristics:

  • Detergent selection:

    • Mild non-ionic detergents (e.g., n-dodecyl-β-D-maltoside or digitonin) are preferred for membrane protein extraction

    • Detergent concentration should be optimized to prevent protein aggregation while avoiding denaturation

    • Detergent exchange may be necessary during purification steps

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using histidine tags

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Ion exchange chromatography for further purification

    • Affinity purification using antibodies or ligands specific to PsaL

  • Conformational verification:

    • Circular dichroism spectroscopy to assess secondary structure

    • Tryptophan fluorescence to evaluate tertiary folding

    • Binding assays with known interaction partners

    • Limited proteolysis patterns compared to native protein

  • Stability considerations:

    • Optimize buffer composition (pH, ionic strength, stabilizing additives)

    • Include glycerol or sucrose to prevent aggregation

    • Consider adding lipids to mimic the native membrane environment

    • Store in conditions that prevent freeze-thaw damage

How can researchers effectively analyze the integration of recombinant PsaL into functional PSI complexes?

Analyzing the integration of recombinant PsaL into PSI complexes requires techniques for both structural and functional assessment:

  • Structural integration analysis:

    • Blue-native gel electrophoresis to visualize intact PSI complexes

    • Sucrose density gradient centrifugation to separate complexes by size

    • Immunoprecipitation to confirm protein-protein interactions

    • Mass spectrometry to identify complex composition

  • Functional assessment:

    • P700 oxidation-reduction kinetics using absorbance spectroscopy

    • Electron transfer rates from plastocyanin to ferredoxin

    • Energy transfer efficiency using time-resolved fluorescence

    • Photosynthetic activity measurements in reconstituted systems

  • Imaging approaches:

    • Transmission electron microscopy of negatively stained complexes

    • Cryo-electron microscopy for high-resolution structural analysis

    • Atomic force microscopy for topological assessment

    • Fluorescence microscopy with tagged components to track localization

  • Data analysis considerations:

    • Quantitative comparison with native complexes as reference standards

    • Statistical analysis of multiple independent reconstitution experiments

    • Modeling of structure-function relationships based on experimental data

What quality control measures should be implemented when working with recombinant PsaL?

Rigorous quality control is essential when working with recombinant PsaL:

  • Expression verification:

    • Western blotting with antibodies specific to PsaL or attached tags

    • Mass spectrometry to confirm protein identity

    • Quantitative PCR to verify transcript levels during expression

    • SDS-PAGE to assess purity and approximate molecular weight

  • Structural integrity assessment:

    • Secondary structure analysis via circular dichroism

    • Thermal stability using differential scanning calorimetry

    • Proper folding assessment via intrinsic tryptophan fluorescence

    • Native PAGE to evaluate oligomeric state

  • Functional validation:

    • Binding assays with known interaction partners

    • Activity assays if enzymatic or binding functions are known

    • Reconstitution experiments to test incorporation into PSI complexes

    • Comparison with native protein isolated from M. aeruginosa

  • Reproducibility measures:

    • Detailed documentation of all expression and purification parameters

    • Implementation of standardized protocols across experiments

    • Use of different batches of recombinant protein for critical experiments

    • Inclusion of appropriate positive and negative controls

How can recombinant PsaL be utilized to study the mechanisms of cyanobacterial bloom formation?

Recombinant PsaL offers valuable tools for investigating bloom formation mechanisms:

  • Photosynthetic efficiency analysis:

    • Compare PsaL variants from bloom-forming vs. non-bloom-forming strains

    • Assess how PsaL modifications affect light harvesting under different environmental conditions

    • Determine whether specific PsaL characteristics confer competitive advantages during bloom initialization

  • Environmental adaptation studies:

    • Examine how PsaL expression changes during different bloom stages

    • Investigate light adaptation mechanisms involving PsaL-mediated energy transfer

    • Analyze how nutrient limitations affect PsaL function and PSI remodeling

  • Microcystin relationship:

    • M. aeruginosa can produce microcystins, liver toxins that have been associated with health risks

    • Explore whether PsaL function is linked to toxin production during bloom formation

    • Investigate whether recombinant PsaL can be used as a biomarker for potentially toxic blooms

  • Applied methodologies:

    • Develop antibodies against recombinant PsaL for field detection of specific M. aeruginosa strains

    • Create biosensors using PsaL-binding domains to monitor bloom composition

    • Engineer modified strains with altered PsaL to test bloom competition hypotheses

What insights can comparative analysis of PsaL from different cyanobacterial species provide?

Comparative analysis of PsaL across cyanobacterial species can yield important evolutionary and functional insights:

  • Evolutionary conservation pattern:

    • Sequence alignment to identify highly conserved regions indicating critical functional domains

    • Phylogenetic analysis to trace the evolutionary history of PsaL adaptations

    • Identification of species-specific modifications that may reflect ecological adaptation

  • Structure-function relationships:

    • Homology modeling based on crystal structures from model organisms

    • Identification of species-specific structural features that may correlate with habitat preferences

    • Prediction of functional differences based on structural variations

  • Experimental approaches:

    • Expression of PsaL from different species in a common recombinant system

    • Functional complementation studies in PsaL-deficient mutants

    • In vitro reconstitution with PSI components to test cross-species compatibility

  • Ecological correlations:

    • Analysis of whether PsaL variations correlate with environmental niches

    • Investigation of adaptation to different light environments

    • Determination of whether specific PsaL features contribute to toxic bloom formation in different cyanobacterial species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.