Recombinant Microcystis aeruginosa Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your own protocols.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbA1; MAE_10220; psbA2; MAE_10380; psbA3; MAE_10510; psbA4; MAE_10800; psbA5; MAE_58140; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Microcystis aeruginosa (strain NIES-843)
Target Names
psbA1
Target Protein Sequence
MTTTLQQRESASLWEQFCQWITSTNNRLYIGWFGVIMIPTLLTATTCFIIAFIAAPPVDI DGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL LGVFCYLGRQWELSFRLGMRPWICVAYSAPVSAATAVFLIYPIGQGSFSDGMPLGISGTF NFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEIESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVIGIWFTAMGVSTMAFNLNGF NFNQSILDSQGRVIGTWADVLNRAGIGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, producing O₂ and a proton gradient used for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein in Microcystis aeruginosa and what is its function?

The Photosystem Q(B) protein in Microcystis aeruginosa (also known as PSII D1 protein) is a critical component of Photosystem II, encoded by the psbA gene. It functions as the primary acceptor of electrons in the photosynthetic electron transport chain. This 344-amino acid membrane protein contains multiple transmembrane domains and plays a crucial role in photosynthetic electron transport and water oxidation processes . The protein is essential for light energy conversion in cyanobacteria and contains binding sites for quinone molecules that facilitate electron transfer from the reaction center to the plastoquinone pool.

How should researchers properly store and reconstitute recombinant Photosystem Q(B) protein?

Proper storage and reconstitution of recombinant Microcystis aeruginosa Photosystem Q(B) protein requires specific conditions to maintain structural integrity and function:

Storage protocol:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

  • Long-term storage requires aliquoting with glycerol (recommended final concentration: 50%)

Reconstitution protocol:

  • Briefly centrifuge the protein vial to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol (5-50% final concentration) for long-term storage

  • Store the reconstituted protein in working aliquots at -20°C/-80°C

The protein is typically maintained in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 to ensure stability .

What expression systems are most effective for producing recombinant Microcystis aeruginosa Photosystem Q(B) protein?

The most effective expression system for producing recombinant Microcystis aeruginosa Photosystem Q(B) protein is E. coli, though specific considerations apply:

Recommended expression system protocols:

  • Clone the psbA1 gene into a vector containing an N-terminal His-tag (such as pET-based vectors)

  • Express in E. coli strains optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

  • Induce expression at lower temperatures (16-20°C) to improve proper folding

  • Extract using mild detergents that maintain membrane protein structure

  • Purify using Ni-agarose affinity chromatography under native conditions

For functional studies, researchers have successfully expressed the Microcystis psbA gene in plasmids such as pUCP22NotI for complementation studies in related organisms . When expressing membrane proteins like Photosystem Q(B), optimization of induction conditions and detergent selection are critical for obtaining properly folded, functional protein.

How is Photosystem Q(B) protein expression related to microcystin production in Microcystis aeruginosa?

The relationship between Photosystem Q(B) protein expression and microcystin production in Microcystis aeruginosa is complex and influenced by photosynthetic activity:

  • Light-dependent regulation: Both photosynthesis and microcystin production are regulated by light intensity. Under high light conditions (>50 μmol photons m^-2 s^-1), there is increased expression of mcy genes encoding microcystin biosynthesis enzymes .

  • Protein-toxin interaction: Microcystin has been shown to bind specifically to certain photosynthetic proteins, including RubisCO (RbcL), under high light conditions. This binding is enhanced during oxidative stress and appears to protect these proteins .

  • Functional relationship: Proteomic studies comparing wild-type and microcystin-deficient mutants have shown differential accumulation of photosynthetic proteins, suggesting that microcystin influences protein stability in the photosynthetic apparatus .

  • Regulatory pathways: Phosphoproteomics analysis indicates that toxin-producing strains have different phosphorylation patterns in proteins associated with photosynthesis compared to non-toxic strains, particularly in redox homeostasis and energy metabolism proteins .

These findings suggest that microcystin production is integrated with photosynthetic activity, with microcystin potentially playing a role in protecting photosynthetic machinery under stress conditions, particularly high light exposure .

What methodologies can distinguish between toxic and non-toxic Microcystis aeruginosa strains based on photosystem proteins?

Several methodologies can distinguish between toxic and non-toxic Microcystis aeruginosa strains based on photosystem proteins:

1. Phosphoproteomic analysis:

  • Phosphoproteomics can identify differences in protein phosphorylation patterns between toxic and non-toxic strains

  • In toxic strains, 26 phosphorylation sites in 18 proteins have been identified

  • In non-toxic strains, 59 phosphorylation sites in 37 proteins have been identified

  • Only seven phosphorylated proteins overlap between toxic and non-toxic strains

2. Gene expression analysis:

  • qPCR analysis of microcystin synthetase genes (mcyA, mcyD, mcyG, mcyJ) can confirm toxin-producing capability

  • Toxic strains express these genes while non-toxic strains do not

3. Proteomic comparison:

  • Two-dimensional gel electrophoresis followed by mass spectrometry can identify differentially expressed photosynthetic proteins

  • Proteins involved in photosynthesis, energy metabolism, and carbon fixation are typically up-regulated in toxin-producing strains

4. Functional photosynthetic analysis:

  • Pulse amplitude modulated fluorometry (PAM) can assess photosynthetic apparatus and correlate photosynthetic capacity with toxin production potential

These approaches provide complementary information, with phosphoproteomics offering the most detailed insights into the regulatory differences between toxic and non-toxic strains.

How does electromagnetic radiation affect the expression and function of Photosystem Q(B) protein in Microcystis aeruginosa?

Electromagnetic radiation significantly impacts the expression and function of Photosystem Q(B) protein in Microcystis aeruginosa:

Effects of electromagnetic radiation (1.8 GHz, 40 V/m):

  • Differential protein expression:

    • Electromagnetic radiation alters the expression of 30 proteins in M. aeruginosa

    • 15 proteins are up-regulated and 15 are down-regulated

    • Photosystem II components, including cytochrome b559 α subunit, cytochrome C550, and PsbY show decreased expression levels

  • Targeted impact on photosynthetic machinery:

    • Electromagnetic radiation specifically affects:

      • Photosynthetic pigment function

      • Photosystem II potential activity

      • Photosynthetic electron transport processes

      • Photosynthetic phosphorylation processes

  • Regulatory mechanism:

    • The photoreaction system appears to be a primary target of electromagnetic radiation

    • The effect is not on the functional proteins themselves but on their expression processes

    • The photoreaction system may be a "shared target effector" responding to both light and electromagnetic radiation

These findings have significant implications for understanding how environmental electromagnetic radiation might affect cyanobacterial blooms and photosynthetic efficiency in aquatic ecosystems.

What effect does high light intensity have on Photosystem Q(B) protein and its interaction with other cellular components?

High light intensity significantly affects Photosystem Q(B) protein and its interactions with other cellular components in Microcystis aeruginosa:

  • Protein-microcystin binding:

    • Under high light conditions (700 μmol photons m^-2 s^-1), microcystin increasingly binds to specific proteins

    • This binding is enhanced after just one hour of high light exposure

    • The binding is reversible when cells are returned to low light conditions (30 μmol photons m^-2 s^-1)

  • Differential protein accumulation:

    • High light conditions alter the accumulation of photosynthetic proteins

    • The RubisCO large subunit (RbcL) shows differential expression patterns between wild-type and microcystin-deficient mutants under high light

    • Two RbcL isoforms (52-55 kDa) are detected, potentially indicating high protein turnover rates

  • Protection mechanism:

    • Microcystin binding to photosynthetic proteins under high light appears to be a protective mechanism

    • This interaction may prevent protein damage during oxidative stress

    • When microcystin is absent (in mutant strains), photosynthetic proteins show altered accumulation patterns

  • Thylakoid association:

    • Immunogold-labeling shows that intracellular microcystin is associated with the thylakoid region where Photosystem II is located

    • This suggests a direct functional link between microcystin and photosynthesis under high light conditions

These observations indicate that Photosystem Q(B) protein and other photosynthetic components undergo complex regulatory changes in response to high light, with microcystin playing a potentially protective role.

What are the optimal culture conditions for studying Microcystis aeruginosa photosystem proteins in laboratory settings?

Optimal culture conditions for studying Microcystis aeruginosa photosystem proteins in laboratory settings include:

Standard culture protocol:

  • Medium: CB medium (Kasai et al., 2004) is recommended for consistent growth

  • Light conditions: 12/12-h light/dark photocycle with light intensity of 21 μmol photons/m^2/s

  • Temperature: 30°C is optimal for most strains

  • Gas supplementation: 0.5% CO₂ (v/v) aeration improves growth rates

  • Culture vessels: Glass flasks with adequate surface area for gas exchange

Synchronized culture technique:
For studies requiring synchronized cells (useful for protein expression studies):

  • Subject cells to 36h darkness (cell division arrest)

  • Transfer to continuous illumination (block-released method)

  • This minimizes variation in cell cycle stages and protein expression patterns

Sample collection for protein analysis:

  • Filter culture through 3.0-μm PTFE membrane filters

  • Resuspend cells in stop solution (phenol:ethanol, 5:95 v/v)

  • Store at -80°C

  • Complete collection within 20 minutes to prevent degradation of labile proteins

These conditions provide reproducible growth while maintaining physiological protein expression patterns for photosystem studies.

What techniques are most effective for studying the protein-protein interactions of Photosystem Q(B) in cyanobacteria?

Several complementary techniques are particularly effective for studying protein-protein interactions of Photosystem Q(B) in cyanobacteria:

1. Chemical cross-linking coupled with mass spectrometry:

  • Chemical cross-linkers (such as EDC or DTSSP) can capture transient protein-protein interactions

  • Cross-linked proteins can be analyzed by LC-MS/MS to identify interaction partners

  • This approach has successfully identified interactions between PsbQ and other photosystem components, such as CP47 and PsbO

2. Immunogold labeling and electron microscopy:

  • Can visualize the spatial distribution of proteins within the thylakoid membrane

  • Has been used to demonstrate that microcystin associates with the thylakoid region where Photosystem II is located

3. Genetic complementation studies:

  • Expressing the Microcystis psbA gene in mutant strains of other cyanobacteria

  • This approach allows functional validation of protein-protein interactions

  • For example, complementation of P. aeruginosa R364 pilT mutant with M. aeruginosa pilT has been performed to study function

4. Co-immunoprecipitation with recombinant tagged proteins:

  • His-tagged recombinant proteins can be used to pull down interaction partners

  • Analyzing both wild-type and microcystin-deficient mutants can reveal toxin-dependent interactions

5. In vitro binding assays with purified components:

  • Expression of recombinant proteins (such as RbcL) and testing their binding to purified microcystin

  • This can be analyzed via immunoblotting with specific antibodies

Combining these approaches provides comprehensive insights into the interaction network of Photosystem Q(B) protein in cyanobacterial cells.

How many gene variants of psbA exist in Microcystis aeruginosa and how do they differ functionally?

Microcystis aeruginosa possesses multiple psbA gene variants encoding the Photosystem Q(B) protein, with important functional implications:

Gene variants identified:

  • psbA1 (MAE_10220)

  • psbA2 (MAE_10380)

  • psbA3 (MAE_10510)

  • psbA4 (MAE_10800)

  • psbA5 (MAE_58140)

All these genes encode the Photosystem II protein D1 (also known as the PSII D1 protein or Photosystem Q(B) protein) . The existence of multiple gene copies suggests differential expression patterns under varying environmental conditions.

Functional differences:

  • Environmental responsiveness: Different psbA variants may be upregulated under different light intensities or stress conditions

  • Protein turnover: Multiple gene copies ensure continuous replacement of the D1 protein, which has one of the highest turnover rates in the photosynthetic apparatus

  • Strain variation: Expression patterns of these genes may differ between toxic and non-toxic strains

This gene redundancy likely represents an adaptation to the variable environmental conditions encountered by M. aeruginosa in aquatic ecosystems, allowing for flexible photosynthetic response under changing conditions.

What are the challenges in expressing and purifying functional recombinant Photosystem Q(B) protein for structural studies?

Expressing and purifying functional recombinant Photosystem Q(B) protein for structural studies presents several significant challenges:

1. Membrane protein solubility issues:

  • As an integral membrane protein with multiple transmembrane domains, Photosystem Q(B) protein is highly hydrophobic

  • Proper solubilization requires careful selection of detergents to maintain native structure

  • Commonly used detergents include n-dodecyl-β-D-maltopyranoside (DDM) or digitonin

2. Maintaining protein stability:

  • The protein is susceptible to degradation during purification

  • Samples must be processed quickly and kept at 4°C

  • Addition of protease inhibitors is essential

  • Avoiding repeated freeze-thaw cycles is critical

3. Expression system limitations:

  • E. coli expression systems may not provide all post-translational modifications

  • Protein folding may be compromised in heterologous expression systems

  • Toxicity to host cells can limit yield

4. Purification complexity:

  • Although His-tagging facilitates purification, the tag may affect structure or function

  • Achieving >90% purity as determined by SDS-PAGE requires optimization

  • The protein must be maintained in appropriate buffer (e.g., Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

5. Functional validation requirements:

  • Ensuring the recombinant protein retains native function

  • Testing electron transport capacity

  • Verifying proper integration into artificial membrane systems

For successful structural studies, these challenges must be addressed through careful optimization of expression conditions, purification protocols, and stability assessments.

How does the structure and function of Microcystis aeruginosa Photosystem Q(B) protein compare to that of other cyanobacterial species?

The Microcystis aeruginosa Photosystem Q(B) protein shares fundamental structural and functional characteristics with other cyanobacterial species, but also exhibits important differences:

Structural similarities:

  • Core transmembrane architecture is conserved across cyanobacteria

  • Quinone binding pocket structure is highly conserved

  • Key electron transport chain interfaces maintain similar organization

Functional conservation:

  • Primary role in electron transport from photosystem II reaction center to plastoquinone pool is maintained

  • Response to light and involvement in water oxidation is consistent across species

Notable differences from other cyanobacteria:

  • Synechocystis sp. PCC 6803 comparison:

    • While both species contain PsbQ proteins that regulate water-splitting activity, the binding sites and interactions differ

    • In Synechocystis, PsbQ binds to CP47 and PsbO near the lumenal side of PSII

    • Binding partners may vary in M. aeruginosa based on its specific photosystem architecture

  • Thermophilic cyanobacteria comparison:

    • Crystal structures of PSII from thermophilic cyanobacteria lack PsbQ, suggesting differences in extrinsic protein requirements

    • M. aeruginosa likely has adaptations for mesophilic environments that affect protein-protein interactions in the photosystem complex

  • Environmental adaptations:

    • M. aeruginosa Photosystem Q(B) protein may have specific adaptations for freshwater environments and bloom formation conditions

    • These adaptations could include different lipid interactions or stability characteristics

These comparative aspects are important for understanding the evolution of photosynthetic machinery across cyanobacterial lineages and for targeting specific species in environmental management contexts.

What role does phosphorylation play in regulating Photosystem Q(B) protein function in different cyanobacteria?

Phosphorylation plays a crucial regulatory role in Photosystem Q(B) protein function in cyanobacteria, with significant implications for photosynthetic activity:

Phosphorylation patterns in Microcystis aeruginosa:

  • Strain-specific differences:

    • Toxic strains: 26 phosphorylation sites identified in 18 proteins

    • Non-toxic strains: 59 phosphorylation sites identified in 37 proteins

    • Only seven phosphorylated proteins overlap between strains

  • Functional impact:

    • Phosphorylation affects proteins involved in redox homeostasis, energy metabolism, and photosynthesis

    • These modifications are highly associated with microcystin generation, which is an energy-consuming process

Regulatory mechanisms across cyanobacteria:

  • Environmental response regulation:

    • Phosphorylation status changes in response to light intensity

    • Oxidative stress alters phosphorylation patterns

    • Nutrient availability affects phosphorylation of photosystem proteins

  • Cross-talk with toxin production:

    • In toxic strains, the phosphorylation of proteins like PemK-like toxin protein (B0JQN8) appears to be associated with regulatory roles of toxins in physiological activity

    • Protein-protein interaction results indicate that B0JVG8 can directly interact with the PemK-like toxin protein B0JQN8

  • Thylakoid protein regulation:

    • In non-toxic strains, 11 phosphorylated proteins are located in the thylakoid

    • Phosphorylation affects ion binding and oxidoreductase activity, which are important for electron transport in photosynthesis

This complex phosphorylation network represents a sophisticated regulatory system that allows cyanobacteria to modulate photosynthetic efficiency in response to changing environmental conditions.

How can recombinant Photosystem Q(B) protein be utilized for developing biosensors for environmental monitoring?

Recombinant Photosystem Q(B) protein offers significant potential for developing biosensors for environmental monitoring, particularly for detecting contaminants that affect photosynthesis:

Methodological approach:

  • Immobilization strategies:

    • Attachment of His-tagged recombinant Photosystem Q(B) protein to nickel-functionalized electrode surfaces

    • Incorporation into artificial membrane systems that maintain protein functionality

    • Entrapment in sol-gel matrices that provide aqueous microenvironments

  • Detection mechanisms:

    • Electrochemical detection: Measuring electron transfer inhibition in the presence of contaminants

    • Fluorescence-based detection: Monitoring changes in chlorophyll fluorescence when photosynthesis is disrupted

    • Surface plasmon resonance: Detecting binding of specific pollutants to the protein

  • Sensitivity enhancement:

    • Coupling with nanomaterials (quantum dots, carbon nanotubes) to amplify signals

    • Integration with microfluidic platforms for sample concentration

    • Development of multiplexed sensors using different photosystem components

Environmental applications:

  • Detection of herbicides that target photosystem II (atrazine, diuron)

  • Monitoring heavy metal contamination that affects photosynthetic efficiency

  • Assessment of electromagnetic radiation effects on aquatic ecosystems

  • Early warning systems for conditions that might promote cyanobacterial blooms

The advantage of using recombinant Photosystem Q(B) protein for these applications is the direct relationship between sensor response and physiological impact, providing ecologically relevant measurements of environmental contaminants.

What are the emerging techniques for studying the dynamic structural changes of Photosystem Q(B) protein during electron transport?

Several cutting-edge techniques are emerging for studying the dynamic structural changes of Photosystem Q(B) protein during electron transport:

1. Time-resolved X-ray crystallography:

  • Captures structural snapshots at different stages of electron transport

  • Uses pump-probe approaches with ultrafast X-ray pulses

  • Can resolve conformational changes at femtosecond to millisecond timescales

2. Cryo-electron microscopy (Cryo-EM):

  • Allows visualization of protein complexes in near-native environments

  • Can capture different conformational states through particle classification

  • Recent advances enable near-atomic resolution of membrane protein complexes

3. Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Measures solvent accessibility changes during protein dynamics

  • Can identify regions that undergo conformational changes during electron transport

  • Particularly valuable for membrane proteins where crystallization is challenging

4. Advanced cross-linking mass spectrometry:

  • Identifies dynamic protein-protein interactions using photo-activatable cross-linkers

  • Can capture transient interactions during the electron transport process

  • Has been successfully applied to photosystem complexes to map protein interactions

5. Single-molecule FRET (Förster Resonance Energy Transfer):

  • Measures distances between fluorescently labeled residues

  • Can track real-time conformational changes during electron transport

  • Provides insights into heterogeneity of protein dynamics

6. Computational molecular dynamics simulations:

  • Models protein movements based on experimental structures

  • Can simulate electron transport events at atomic resolution

  • Increasingly accurate with improvements in force fields for membrane environments

Integration of these techniques provides comprehensive insights into the structural dynamics of Photosystem Q(B) protein during photosynthetic electron transport, advancing our understanding of this fundamental biological process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.