Recombinant Microcystis aeruginosa Proton extrusion protein PcxA (pcxA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
pcxA; MAE_57840; Proton extrusion protein PcxA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
full length protein
Species
Microcystis aeruginosa (strain NIES-843)
Target Names
pcxA
Target Protein Sequence
MNLNRILQGVNQWLLQTPERSLDEAYHAALKIKEIEDKHFQGRKVANEFSNYGSSTNSYF IAEVKGYLQKIKVRLTEFKASRSIVNTFGPNQPTINNGVITVTTDVCLKKLQFIDSIIGK YQDNYWQEDIQDVPKSIQNRNFEQETAKNKTSRNRSFLAAGSIEDEEIIKSNKSQKATEK PGVLPRSFVNTFNRIKQEIDPQAEESEEAVLKKFRNSRYKTAISLKFILLLIIVPLLTQQ LTKTFLITPLVNKYFQQQEQFIFINQDLEEEAFSELRRFEEALHFRGMIGLAPKLSNEEI EGEITKKAAVLSEEFRQRGLNAIANIFADICSLIAFGFVVAFSRREIEIVKSFLDGILYN LSDSAKAFLIILFTDIFVGFHSPHGWEVILEGLSRHFGLPENRQFNFLFIATFPVILDTV LKYWIFRYLNRISPSAVATYRNMNE
Uniprot No.

Target Background

Function
PcxA is involved in light-induced Na(+)-dependent proton extrusion. It also appears to play a role in CO(2) transport.
Database Links
Protein Families
Cema family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of PcxA in Microcystis aeruginosa?

PcxA (Proton extrusion protein A) plays a critical role in maintaining pH homeostasis in Microcystis aeruginosa by facilitating proton efflux across the cell membrane. Similar to other cyanobacterial proton extrusion systems, PcxA is likely involved in cellular adaptation to environmental pH fluctuations, which is particularly important for blooming events in freshwater ecosystems. The protein functions within a complex regulatory network that includes nitrogen control mechanisms similar to those observed with NtcA transcription factors .

How is the pcxA gene organized in the M. aeruginosa genome?

The pcxA gene in M. aeruginosa is organized within an operon structure with nearby regulatory elements. While specific details of the pcxA operon are still being characterized, research methodologies similar to those used for ntcA gene isolation can be applied. Adaptor-mediated PCR techniques have proven effective for isolating and characterizing such genes from M. aeruginosa PCC 7806 . The gene organization likely includes promoter regions responsive to environmental stimuli, particularly those related to pH and nitrogen availability.

What expression systems are recommended for recombinant PcxA production?

For recombinant expression of M. aeruginosa PcxA, E. coli-based expression systems using vectors such as pUCP22NotI have proven effective for similar cyanobacterial proteins . The methodology involves:

  • Gene amplification using PCR with specifically designed primers

  • Cloning into appropriate expression vectors (similar to approaches used for PilT)

  • Transformation into E. coli DH5α under appropriate selection conditions

  • Protein expression induction and purification using His-tag affinity chromatography

Expression yields can be optimized by adjusting induction conditions (temperature, IPTG concentration) and using specialized E. coli strains designed for membrane protein expression.

What are the best methods for isolating and purifying recombinant PcxA?

Isolation and purification of recombinant PcxA requires a specialized approach due to its membrane-associated nature:

Purification StepMethodCritical Parameters
Cell LysisSonication or French pressBuffer pH 7.4-8.0 with protease inhibitors
Membrane Fraction IsolationUltracentrifugation100,000 × g, 1 hour at 4°C
SolubilizationDetergent extraction1% DDM or LDAO
Affinity PurificationNi-NTA chromatography20-250 mM imidazole gradient
Further PurificationSize exclusion chromatographySuperdex 200 column

The choice of detergent is critical for maintaining protein activity. Testing multiple detergents in small-scale extractions prior to large-scale purification is recommended. Additionally, incorporation of stabilizing agents such as glycerol (10-15%) in all buffers helps maintain protein integrity .

How can I assess the functionality of recombinant PcxA?

Assessment of recombinant PcxA functionality can be performed using a combination of approaches:

  • ATPase activity assays measuring Pi release (similar to methods used for PilT with expected activity in the range of 30-40 nmol Pi min⁻¹ mg protein⁻¹)

  • Proton transport assays using pH-sensitive fluorescent dyes

  • Reconstitution into proteoliposomes followed by proton flux measurements

  • Complementation studies in mutant strains lacking functional proton extrusion capabilities

For ATPase activity assays, it's essential to establish the optimal cation requirements (typically Mg²⁺) and pH conditions (typically pH 7.0-8.0). Controls should include samples with EDTA to chelate metal ions and demonstrate metal dependency of the enzyme activity.

What expression conditions optimize the yield of functional recombinant PcxA?

Optimization of recombinant PcxA expression involves systematic testing of multiple variables:

ParameterRange to TestNotes
Expression HostBL21(DE3), C41(DE3), C43(DE3)C41/C43 often better for membrane proteins
Induction Temperature16°C, 25°C, 37°CLower temperatures often improve folding
IPTG Concentration0.1-1.0 mMStart with lower concentrations
Induction Duration4h, 8h, overnightLonger times at lower temperatures
Media CompositionLB, TB, auto-inductionTB or auto-induction often increases yield
AdditivesGlycerol, specific ions10% glycerol can improve stability

Using a design of experiments (DOE) approach similar to principal component analysis-based methods can efficiently identify optimal conditions by testing combinations of variables rather than one-factor-at-a-time optimization .

How does PcxA interact with other components of M. aeruginosa pH regulation systems?

PcxA likely functions within a complex network of proteins involved in pH homeostasis. While specific interaction studies for PcxA are still emerging, approaches for characterizing these interactions include:

  • Co-immunoprecipitation with tagged PcxA to identify interacting partners

  • Bacterial two-hybrid assays to screen for direct protein-protein interactions

  • Cross-linking followed by mass spectrometry to identify nearby proteins in the membrane

  • Comparative transcriptomics to identify genes co-regulated with pcxA under pH stress

Research on NtcA in M. aeruginosa suggests that transcription factors can have autoregulatory properties and control multiple cellular processes . Similar regulatory mechanisms might apply to pcxA expression, potentially linking pH regulation with nitrogen metabolism.

What structural features of PcxA are critical for its proton extrusion function?

Critical structural features of PcxA can be investigated through:

  • Site-directed mutagenesis of conserved residues followed by functional assays

  • Homology modeling based on related proteins with known structures

  • Structural prediction using AlphaFold or similar tools

  • Chimeric protein construction combining domains from different proton transporters

Recent studies on PilT proteins have shown that differences in specific residues can dramatically affect functionality even between related cyanobacterial species . Similar critical residues likely exist in PcxA that determine its substrate specificity and transport kinetics.

How do environmental factors influence pcxA expression in Microcystis aeruginosa?

Environmental regulation of pcxA expression can be studied using:

  • qPCR analysis of pcxA transcripts under varying conditions (similar to methods used for pilA, pilB, pilC, and pilT genes)

  • Reporter gene fusions (e.g., pcxA promoter-GFP) to monitor expression in live cells

  • Transcript analysis using RNA-Seq to identify co-regulated genes

  • Chromatin immunoprecipitation to identify transcription factors binding to the pcxA promoter

Expected environmental factors influencing expression include:

Environmental FactorExpected EffectExperimental Approach
External pHIncreased expression at extreme pHCulture exposure to pH 6.0-9.5
Nitrogen availabilityPossible co-regulation with N metabolismGrowth in varying N sources
Light intensityPotential circadian regulationLight/dark cycling experiments
Carbon dioxide levelsLinked to carbon concentration mechanismsVarying CO₂ concentrations
Bloom conditionsUpregulation during dense growthComparison of different growth phases

How can I distinguish between PcxA activity and other proton transport mechanisms?

Distinguishing PcxA-specific activity requires careful experimental design:

  • Generate specific inhibitors or antibodies against PcxA

  • Create knockout/knockdown mutants of pcxA for comparative studies

  • Perform complementation studies with wild-type and mutant versions of PcxA

  • Use heterologous expression systems where background proton transport is minimal

Controls should include measurements in the presence of known inhibitors of other proton transport systems (e.g., DCCD for F-type ATPases, CCCP as a protonophore), allowing isolation of PcxA-specific activity.

What statistical approaches are recommended for analyzing PcxA functional data?

For analyzing PcxA functional data:

  • For kinetic measurements: non-linear regression analysis to determine Km and Vmax values

  • For comparative studies: ANOVA followed by appropriate post-hoc tests (Tukey's or Dunnett's)

  • For expression studies: relative quantification using the 2^(-ΔΔCt) method with appropriate reference genes

  • For complex datasets: multivariate analysis techniques

How can I address potential artifacts in recombinant PcxA studies?

Potential artifacts in recombinant protein studies include:

  • Expression-related artifacts: Compare multiple expression systems and conditions to ensure consistent results

  • Purification-related artifacts: Test multiple purification methods and detergents

  • Tag interference: Compare N-terminal, C-terminal, and tag-free versions of the protein

  • Aggregation artifacts: Use size exclusion chromatography and dynamic light scattering to confirm monomeric state

  • Functional relevance: Validate in vitro findings with in vivo experiments

Specific controls should include mock-purified samples from expression hosts lacking the pcxA gene to identify background activities or contaminants co-purifying with the target protein.

How might PcxA research contribute to understanding Microcystis bloom dynamics?

PcxA research can contribute to understanding bloom dynamics through:

  • Characterization of pH adaptation mechanisms that enable Microcystis to dominate in various water conditions

  • Identification of potential links between proton extrusion, carbon concentration mechanisms, and toxin production

  • Development of molecular markers for detecting bloom-forming potential in environmental samples

  • Understanding the energetic requirements of pH homeostasis during bloom formation

The nitrogen-controlled factor NtcA has been identified as a key component in the regulatory network controlling microcystin production . Similar regulatory connections may exist between PcxA activity and toxin production, potentially linking pH regulation to bloom toxicity.

What are the challenges in translating in vitro PcxA studies to in vivo function?

Translating in vitro findings to in vivo function presents several challenges:

  • The complex cellular environment may include unknown interaction partners absent in purified systems

  • The natural lipid environment differs significantly from detergent micelles or synthetic liposomes

  • Regulatory mechanisms active in vivo may be missing in reconstituted systems

  • Expression levels of recombinant protein may not match physiological levels

Approaches to address these challenges include the development of genetic tools for M. aeruginosa to allow tagged-protein expression and purification from the native organism, or creation of fluorescently labeled versions for localization studies in live cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.