Recombinant Micronemal protein 6 (MIC6)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Micronemal Protein 6 (MIC6)

Micronemal proteins (MICs) are essential for the invasion of host cells by Toxoplasma gondii, with Micronemal protein 6 (MIC6) being one of these proteins . MIC6 is a part of the MIC1-4-6 complex on the surface of T. gondii, facilitating the parasite's binding to host cells .

Role in Host Cell Invasion

MIC6, along with MIC1 and MIC4, plays a crucial role in the adhesion of T. gondii to host cells, which is the initial step in invasion . The MIC1-4-6 complex is critical for host cell invasion and contributes to parasite virulence in vivo .

Vaccine Potential of MIC6

MIC6 has shown promise as a potential vaccine candidate against T. gondii . Studies indicate that vaccination with MIC6 can elicit immune responses and prolong survival in mice infected with T. gondii .

Immune Response to MIC6

Vaccination with MIC6 has been shown to induce both humoral and cellular immune responses . These responses include increased levels of specific IgG antibodies, interferon-gamma (IFN-γ), interleukin-2 (IL-2), and IL-12 . The induction of Th1-type cellular immune responses is a notable effect of MIC6 vaccination .

Protection Against Toxoplasma gondii Infection

Immunization with MIC6 has demonstrated the ability to reduce mortality and decrease tissue cyst levels in the brains of infected animals . Combining MIC6 with other micronemal proteins, such as MIC1 and MIC4, can result in enhanced protection against T. gondii infection .

MIC6 in DNA Vaccines

MIC6 has been used in DNA vaccines to combat T. gondii . A DNA vaccine expressing a fusion protein of T. gondii perforin-like protein 1 (TgPLP1) and MIC6 (pIRESneo/MIC6/PLP1) resulted in reduced brain cyst counts and prolonged survival time in immunized mice .

T-Cell Recall Responses

MIC proteins, including MIC6, elicit cellular immune responses characterized by effector memory T cells . Studies have shown that splenocytes from mice chronically infected with T. gondii produce significantly higher levels of IFN-γ when stimulated with MIC6 .

Dendrograms Grouping Microneme Proteins

Amino acid sequences obtained from available sequence databases at NCBI were used to create dendrograms grouping microneme proteins of T. gondii isolates, showing approximately 99% similarity in their sequences .

Studies on PRMT6 Inhibitors

Protein arginine methyltransferase 6 (PRMT6) plays roles in biological processes associated with cancers . Although this is distinct from MIC6, it shows the importance of studying proteins for therapeutic purposes. Covalent inhibitors of PRMT6 have been developed and studied for their selectivity and effectiveness in cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIC6; Micronemal protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-349
Protein Length
Full Length of Mature Protein
Species
Toxoplasma gondii
Target Names
MIC6
Target Protein Sequence
SPFFAFLPGNGEIADNCSGNPCGGTAAGTCINTPSGYDCRCEPGYVLGVENDQVTCMMPS GVPMANFVQLSETPAACSSNPCGPEAAGTCKETNSGYICRCNQGYRISLDGTGNVTCIVR QESGCEENGCGPPDAVQSCRRLTGTAGRLCVCKENFIATIDASAHITCKRVPPHYRKPPF EFGKGGHPVDSEPSKRQREDEGESREPESDSTEPGRDQERRTPLEESQEPEGSTPDSQQS RGGSGSDSTESEEQGKEREEGSGHAGAIAGGVIGGLLLLSAAGAGVAYMRKSGSGGGEEI EYERGIEAAEASEVEVLVDLDSKTWD
Uniprot No.

Target Background

Function

Escorter protein necessary for the import of MIC1 and MIC4 adhesins into the microneme.

Subcellular Location
Cytoplasmic vesicle, secretory vesicle, microneme membrane; Single-pass type I membrane protein. Secreted. Note=Released as soluble 35 kDa protein after proteolytic processing of the C-terminus (PubMed:11861763).

Q&A

What is Micronemal protein 6 (MIC6) and what organisms express it?

Micronemal protein 6 (MIC6) is a transmembrane protein found in Apicomplexa parasites, particularly in Toxoplasma gondii (TgMIC6) and Neospora caninum (NcMIC6). In N. caninum, the open reading frame of NcMIC6 is 984 bp and encodes a 327 amino acid peptide with an approximate molecular weight of 35-kDa . MIC6 is expressed in the micronemes, which are specialized secretory organelles located at the apical end of these parasites. These proteins play a critical role in parasite motility, attachment, and invasion of host cells .

What is the molecular structure and key domains of MIC6?

MIC6 has a complex multi-domain structure that includes:

  • A signal peptide at the N-terminus

  • Three epidermal growth factor-like (EGF) domains

  • Two low complexity regions

  • A transmembrane region

  • A carboxyl-terminal cytoplasmic domain

The EGF domain is particularly important, composed of 30-40 amino acid residues containing six cysteine residues that form three disulfide bonds. This domain is evolutionarily conserved and typically presents in membrane-bound proteins and extracellular eukaryotic proteins, increasing specificity through multivalent interaction . The C-terminal cytoplasmic domain contains a classification signal based on tyrosine residues that is critical for the correct transport of the MIC1/4/6 complex to the micronemes .

How does MIC6 form protein complexes and what is their significance?

MIC6 forms a complex with two soluble microneme proteins, MIC1 and MIC4, which has been confirmed through co-immunoprecipitation studies . In this complex, MIC6 serves as a transmembrane anchor for the complex during host cell invasion.

The complex formation appears to be functionally significant:

  • The TgMIC1 galectin-like domain may assist in the folding of the TgMIC6 C-terminal, allowing the complex to exit from the endoplasmic reticulum and the Golgi apparatus

  • The complex is then accurately transported into the microneme through the sorting signal

  • This complex participates not only in invasion of T. gondii but also in the pathogenesis and immune escape of the parasite

Research has shown that knockout of MIC6 affects the expression and secretion of MIC1 and MIC4, although it does not change their subcellular localization, suggesting that MIC6 plays a role in maintaining the stability of the complex .

What methodologies are effective for expressing and purifying recombinant MIC6?

Several approaches have been documented for expressing recombinant MIC6:

Bacterial Expression Systems:

  • The coding sequence of MIC6 can be amplified by PCR from genomic DNA or cDNA using specific primers with appropriate restriction sites

  • For NcMIC6, primers such as MIC6F (5′-AAACCCGGGATGAGGCTCTTCCGGTGCT-3′) and MIC6R (5′-CGTCTAGATTAATCCCATGTTTTGCTATCC-3′) have been used successfully

  • For proper folding in prokaryotic systems, additional components such as fusion partners or co-expression of folding catalysts are often required for correct disulfide bonding of the cysteine-rich domains

Eukaryotic Expression Systems:

  • For in vitro expression, MIC6 has been cloned into vectors like pIRESneo

  • When using eukaryotic systems, it's important to note that glycosylation patterns may differ from the native protein

  • Enzymatic deglycosylation or mutation of glycosylation sites can be employed to prevent erroneous glycosylation

Important Considerations:

  • Due to the AT richness of the Plasmodium and other Apicomplexa genomes, codon optimization is often required for optimal yields in different expression systems

  • Western blotting using antibodies raised against recombinant MIC6 can be used to confirm the size and expression of the protein

  • Immunofluorescence analysis can be performed to verify the correct localization of the recombinant protein

How can the function of MIC6 in parasite invasion and egress be experimentally demonstrated?

Several experimental approaches have been employed to study MIC6 function:

Gene Knockout Studies:

  • Complete knockout of MIC6 in N. caninum (ΔNcMIC6) has demonstrated impairment in invasion and egress abilities

  • ΔNcMIC6 showed smaller plaque size compared to wild-type parasites

Invasion Assays:

  • Pulse invasion assays have demonstrated that NcMIC6 translocates from the apical tip to the posterior end of the parasites during invasion

  • Comparative invasion rates between wild-type and ΔNcMIC6 can quantify the impact of MIC6 on invasion efficiency

Egress Assays:

  • Ionophore-induced egress experiments using calcium ionophore A23187 can be used to measure egress efficiency

  • ΔNcMIC6 shows a strong delay in egress after treatment for different durations compared to wild-type parasites

Transcriptional Analysis:

  • qRT-PCR can be used to measure the transcription levels of genes related to invasion or egress in MIC6 knockout strains

  • Studies have shown that deletion of NcMIC6 significantly reduced transcription levels of egress-related genes including NcCDPK1, NcPLP1, and NcAMA1

What is the potential of MIC6 as a vaccine candidate and how has it been evaluated?

MIC6 has shown promise as a vaccine candidate, particularly when combined with other microneme proteins:

Vaccination Strategies and Results:

  • DNA vaccines expressing MIC6 have been constructed using vectors such as pIRESneo and pVAX

  • A DNA vaccine expressing a TgPLP1/MIC6 fusion protein demonstrated enhanced immune response in Kunming mice

  • Immunization with pIRESneo/MIC6/PLP1 resulted in the lowest brain cyst count and prolonged the survival time of immunized mice compared to control groups

Immune Response Evaluation:

  • Levels of IgG antibody, gamma interferon (IFN-γ), interleukin 2 (IL-2), IL-12, IL-4, and IL-10 can be examined to assess immune response

  • Recombinant protein vaccines using MIC6 have significantly enhanced IgG titers, mixed Th1/Th2 responses with the predominance of IgG2b over IgG1, and high production of IFN-γ and IL-10 cytokines

Protection Assessment:

  • Challenge studies can be conducted where vaccinated mice are infected with parasite cysts (e.g., T. gondii strain PRU) and survival rates are monitored

  • Brain parasite load can be evaluated several weeks after infection to assess protection efficacy

  • Multi-component vaccines including MIC6 have shown higher efficacy:

    • Immunization with TgMIC1-4-6 vaccines boosted protective efficiency, with 80% of immunized mice surviving 30 days post-challenge

    • Brain cyst load reduction ranged from 27.2%–67.8% in mice vaccinated with different MIC proteins

How does knockout of MIC6 affect parasite virulence in animal models?

Studies examining the effect of MIC6 knockout on parasite virulence have shown significant results:

Virulence Assessment:

  • Mice infected with different doses of ΔNcMIC6 (low, middle, and high) showed 100% survival rates during a 30-day observation period, compared to much lower survival rates in wild-type infected mice

  • Control mice infected with wild-type Nc1 at doses of 2 × 10^6, 4 × 10^6, and 8 × 10^6 tachyzoites showed survival rates of only 33.3%, 16.7%, and 16.7%, respectively

Parasite Load:

  • Cerebral parasite load in the ΔNcMIC6 group was significantly decreased compared to the wild-type Nc1 group

  • This reduction in parasite load correlates with the observed increased survival, suggesting MIC6 is important for parasite dissemination and persistence in the host

Mechanism Exploration:

  • Transcriptional analysis revealed that knockout of MIC6 affects multiple pathways:

    • Downregulation of NcCDPK1, NcPLP1, and NcAMA1 which are involved in Ca^2+-dependent signaling and host cell invasion

    • Upregulation of NcRON2, possibly as a compensatory mechanism to ensure correct formation of moving junctions despite impaired AMA1 function

What techniques are most effective for studying protein-protein interactions involving MIC6?

Various techniques have been employed to study MIC6 interactions:

Co-Immunoprecipitation:

  • Co-IP has successfully demonstrated that NcMIC6 forms a complex with NcMIC1 and NcMIC4

  • This technique can be used to identify novel interaction partners of MIC6

Immunofluorescence Colocalization:

  • IFA can be used to examine the subcellular localization of MIC6 and potential interacting partners

  • Studies have shown that MIC6 has a polar labeling pattern consistent with microneme localization

Western Blotting for Complex Formation:

  • Western blotting can evaluate the secretion (in supernatant) and expression (in pellet) of MIC proteins

  • Studies showed that ΔNcMIC6 exhibited reduced secretion and expression of NcMIC1 and NcMIC4 compared to wild-type parasites

Secretion Assays:

  • These assays can determine if MIC6 is released into supernatants during parasite activation

  • Can be used to compare secretion patterns between wild-type and mutant parasites

How can the minimal important change (MIC) value be determined for research involving interventions targeting MIC6?

When evaluating the effectiveness of interventions targeting MIC6 (such as vaccines or inhibitors), determining the minimal important change (MIC) value is critical:

Definition and Methodology:

  • The minimal important change (MIC) is defined as a threshold for a meaningful change from the research perspective

  • This value adds meaningful interpretation to study results and can be used to determine the number of responders in treatment groups

Anchor-Based Methods:

  • The most common approach uses an external criterion (anchor) asking research subjects about change levels on a global rating scale

  • Two recommended methods include the ROC method and the MIC predictive modeling method

Sample Size Considerations:

  • MIC studies should include at least 100 subjects

  • Ideally, the percentage of subjects in the improved group should be approximately 50%, and this percentage should be reported

Application in MIC6 Research:

  • For research on MIC6-targeting interventions, MIC values could help determine whether observed changes in parasite load, immune response, or clinical symptoms represent meaningful improvements

  • When applied to vaccine studies, MIC values could help establish thresholds for determining vaccine efficacy

What are the challenges in expressing properly folded recombinant 6-cysteine proteins like MIC6?

The expression of properly folded MIC6 and similar cysteine-rich proteins presents several challenges:

Disulfide Bond Formation:

  • The EGF domains in MIC6 contain six cysteine residues that form three disulfide bonds, which are critical for proper protein folding and function

  • In prokaryotic expression systems, additional components such as fusion partners or co-expression of folding catalysts are often required for proper disulfide bonding

Glycosylation Considerations:

  • In eukaryotic systems, glycans on Plasmodium and other Apicomplexa proteins are truncated compared to those of other eukaryotes

  • Incorrect glycosylation can affect the conformation of proteins expressed in these systems

  • Enzymatic deglycosylation or mutation of glycosylation sites may be employed to prevent erroneous glycosylation

Codon Optimization:

  • Due to the AT richness of Apicomplexa genomes, codon optimization is often required for optimum yields in different recombinant expression systems

  • The choice of expression system should consider the codon usage bias of the host organism

Verification of Proper Folding:

  • Functional assays, circular dichroism spectroscopy, and limited proteolysis can be used to verify proper protein folding

  • For MIC6, interaction studies with known binding partners (MIC1 and MIC4) can indirectly confirm proper folding

How can antibiotic resistance evaluations be incorporated into MIC6 research?

For microbiology research involving MIC6, understanding antibiotic resistance evaluation methodology is important:

MIC Determination:

  • Minimum Inhibitory Concentration (MIC) is a standard measure for determining the effectiveness of antibiotics against bacterial isolates

  • This should not be confused with Micronemal protein 6 (MIC6), but the methodologies for MIC determination may be relevant in research settings

Examples from Bacterial Research:
The following table provides examples of antibiotic MIC determinations for Burkholderia pseudomallei strains which might serve as a methodological example for researchers:

IsolateAntibiotic MIC (µg/mL)
AMCCAZDOXMEMSXT
MSHR02932/1110.50.4
MSHR04921.5/0.751.511.51
MSHR09342/1210.751
MSHR11411.5/0.751.510.750.75
MSHR37634/220.750.753

Abbreviations: AMC, amoxicillin-clavulanate; CAZ, ceftazidime; DOX, doxycycline; MEM, meropenem; SXT, co-trimoxazole

Relevance to MIC6 Research:

  • Similar standardized methodologies can be applied when testing the effect of compounds targeting MIC6 or parasite function

  • Researchers can adapt these approaches to develop "Minimum Effective Concentration" determinations for anti-parasitic compounds targeting MIC6-dependent functions

What are the most effective methods for studying the role of MIC6 in protein trafficking and localization?

Several methodologies have proven effective for investigating MIC6's role in protein trafficking:

Subcellular Fractionation:

  • Gradient centrifugation techniques can be used to isolate micronemes and other organelles

  • Western blotting of fractions can determine the distribution of MIC6 and associated proteins

Live Cell Imaging:

  • Fluorescently tagged MIC6 can be expressed in parasites to track its movement during invasion and egress

  • Time-lapse microscopy can provide valuable information about the dynamics of MIC6 trafficking

Immunofluorescence Analysis:

  • IFA using specific antibodies against MIC6 has shown that it has a polar labeling pattern consistent with microneme localization

  • Colocalization studies with markers for different organelles can precisely define MIC6's subcellular distribution

Genetic Manipulation:

  • Deletion or mutation of specific domains of MIC6, particularly the tyrosine-based sorting signal in the C-terminal cytoplasmic domain, can elucidate their roles in trafficking

  • Complementation studies in knockout strains can confirm the functionality of specific domains

Pulse-Chase Experiments:

  • These experiments can track the synthesis, processing, and transport of MIC6 through the secretory pathway

  • Can be combined with specific inhibitors of trafficking to identify the pathways involved

How can gene editing technologies be applied to study MIC6 function?

Modern gene editing technologies offer powerful tools for MIC6 research:

CRISPR/Cas9 Applications:

  • CRISPR/Cas9 can be used to generate precise knockout or knockin mutations in MIC6

  • Domain-specific modifications can help elucidate the function of individual domains

  • Conditional knockout systems can study MIC6 function at specific life cycle stages

Site-Directed Mutagenesis:

  • Targeted mutations in key residues of the EGF domains can help understand their role in MIC6 function

  • Mutations in the tyrosine-based sorting signal can elucidate trafficking mechanisms

Reporter Gene Fusions:

  • Fusion of MIC6 with reporter genes can facilitate real-time visualization of its expression and localization

  • Split reporter systems can be used to study MIC6 interactions with other proteins

Validation Methods:

  • Genome sequencing to confirm gene modifications

  • Western blotting and immunofluorescence to verify expression changes

  • Functional assays to assess the impact of genetic modifications on parasite invasion and egress

What novel vaccination strategies might enhance the efficacy of MIC6-based vaccines?

Research suggests several strategies that could enhance MIC6-based vaccine efficacy:

Multi-Antigen Approaches:

  • Combining MIC6 with other microneme proteins (MIC1, MIC4) has shown enhanced protection compared to single-antigen vaccines

  • A DNA vaccine expressing a TgPLP1/MIC6 fusion protein demonstrated better efficacy than single-gene vaccines

Adjuvant Optimization:

  • Co-immunization with adjuvants such as murine IL-18 has been tested with pIRESneo/MIC6/PLP1

  • While this promoted cellular and humoral immune responses, it did not significantly improve cyst reduction or survival, suggesting the need for alternative adjuvant strategies

Delivery System Innovation:

  • Investigation of novel delivery systems such as nanoparticles, liposomes, or virus-like particles could enhance the immunogenicity of MIC6

  • Prime-boost strategies combining DNA and protein-based vaccines might elicit more robust immune responses

Epitope Mapping and Optimization:

  • Identification of immunodominant epitopes within MIC6 could lead to the development of epitope-based vaccines

  • Structural modifications to enhance epitope presentation and recognition by the immune system

Route of Administration:

  • Comparison of different administration routes (intramuscular, intradermal, mucosal) to identify the most effective approach for inducing protective immunity

The data from multi-component vaccine studies showed that immunization with TgMIC1-4-6 provided 80% survival in immunized mice 30 days post-challenge, indicating that combination approaches hold significant promise .

How might comparative genomics approaches advance our understanding of MIC6 function across Apicomplexa species?

Comparative genomics offers valuable insights into MIC6 evolution and function:

Sequence Comparison:

  • Alignment of MIC6 sequences from various Apicomplexa species can identify conserved domains and species-specific variations

  • Analysis of selection pressure on different domains can highlight functionally critical regions

Structural Predictions:

  • Comparative modeling of MIC6 structures from different species can reveal structural conservation and divergence

  • Identification of species-specific structural features might explain host specificity or virulence differences

Transcriptomic Analysis:

  • Comparison of MIC6 expression patterns across species and life cycle stages

  • Identification of conserved regulatory elements in MIC6 promoter regions

Interactome Studies:

  • Cross-species comparison of MIC6 protein-protein interactions

  • Identification of conserved and species-specific interaction partners

Functional Conservation Testing:

  • Cross-species complementation studies (e.g., expressing TgMIC6 in NcMIC6 knockout strains)

  • Evaluation of whether MIC6 functions are conserved across species boundaries

This comparative approach could lead to the identification of broadly effective therapeutic targets with relevance across multiple pathogenic Apicomplexa species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.