Recombinant Micropogonias undulatus Gap junction Cx32.2 protein

Shipped with Ice Packs
In Stock

Description

Functional Roles

Cx32.2 belongs to the connexin family, which forms gap junctions enabling ion and small molecule exchange between cells. Key functional insights include:

Protein Interactions

  • SAP97 binding: The scaffolding protein SAP97 interacts with Cx32.2’s C-terminal (CT) domain via its guanylate kinase (GUK) domain, regulating channel assembly .

  • Calmodulin (CaM) binding: Ca²⁺-loaded CaM induces α-helical structure in the disordered CT domain, modulating channel gating .

Disease-Linked Mutations

Three Charcot-Marie-Tooth disease (CMTX) mutants—R219H, R230C, and F235C—retain channel function but show reduced binding to SAP97 and CaM, implicating disrupted protein interactions in demyelination .

Drug Development

  • Used to study gap junction modulation in neurological disorders .

  • Assays measure compound effects on channel permeability and protein-protein interactions .

Antibody Production

  • Serves as an antigen for generating anti-Cx32.2 antibodies (e.g., ELISA kits) .

Technical Considerations

ChallengeSolution
Hydrophobic aggregationOptimized buffer with trehalose prevents precipitation .
Proteolytic degradationFusion tags (His) enable selective purification of full-length protein .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Gap junction Cx32.2 protein; Connexin-32.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-285
Protein Length
Full Length of Mature Protein
Species
Micropogonias undulatus (Atlantic croaker)
Target Protein Sequence
GDLGFLSKLLDQVQSHSTVIGKIWMTVLFLFRIMVLGAGAESVWGDEQSDFTCNTQQPGC ENVCYDWTFPISHIRFWVLQIIFVSTPTLIYLGHAMHIIQQETKLRARLSSPGGSRLCKQ PKYTNEQGKVKIKGNLLGSYLTQLVFKIIIEAAFIVGQYYLYGFIMVPMFPCSKKPCPFT VECYMSRPTEKTIFIIFMLVVACVSLLLNVIEVFYLICTRVRCGSRAHSHKITSAENPAS LSSPRWPTVEDSLKQNKMNMELETSQSIGGSLDGAKEEKRLLSH
Uniprot No.

Target Background

Function

Gap junctions are composed of clusters of closely packed connexon pairs, transmembrane channels facilitating the diffusion of low-molecular-weight materials between adjacent cells. This protein may play a role in ovarian follicular maturation.

Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Micropogonias undulatus gap junction Cx32.2 protein and what is its structure?

Micropogonias undulatus gap junction Cx32.2 protein is a connexin protein isolated from the Atlantic croaker (Micropogonias undulatus). The mature protein spans amino acids 2-285 of the full sequence . Structurally, it belongs to the connexin family of proteins that form gap junction channels, which are dodecameric structures that facilitate intercellular communication. Like other connexins, it likely forms hexameric hemichannels (connexons) that dock with hemichannels from adjacent cells to create complete intercellular channels .

The protein is available as a recombinant full-length form with His-tag produced in E. coli expression systems, making it suitable for various research applications . The structural characteristics of Cx32.2 likely follow the general connexin architecture with four transmembrane domains, two extracellular loops, one cytoplasmic loop, and cytoplasmic N- and C-terminal domains.

How does Cx32.2 compare functionally with other connexin family members?

The connexin family exhibits diverse functional properties, even among closely related members. Based on studies of similar connexins like Cx32, Micropogonias undulatus Cx32.2 likely participates in forming gap junction channels with specific conductance and permeability characteristics .

While specific data for Micropogonias undulatus Cx32.2 is limited in the provided search results, research on mammalian Cx32 indicates that homotypic junctions (formed by the same connexin type) exhibit slow dependence on transjunctional voltage (Vj) but no dependence on transmembrane potential (Vi-o) . In contrast, heterotypic junctions (formed between different connexin types, such as Cx26 and Cx32) display electrical asymmetry, with conductance changes dependent on the polarity of the transjunctional potential .

These functional differences between homotypic and heterotypic junctions suggest that Cx32.2 may similarly contribute to specialized communication when paired with itself versus other connexins, potentially allowing for sophisticated regulation of intercellular signaling.

What are the recommended initial experimental conditions for working with recombinant Cx32.2 protein?

When working with recombinant Micropogonias undulatus gap junction Cx32.2 protein, researchers should consider the following initial experimental conditions:

  • Storage conditions: Typically stored at -80°C for long-term stability, with aliquoting recommended to avoid repeated freeze-thaw cycles.

  • Buffer compatibility: Most connexin proteins function optimally in physiological buffers with pH 7.2-7.4. For functional studies, buffers containing divalent cations (Ca²⁺, Mg²⁺) are important as they regulate gap junction gating.

  • Expression systems: The protein is successfully expressed in E. coli systems with His-tagging for purification purposes .

  • Solubilization: Due to the transmembrane nature of connexins, mild detergents (such as n-dodecyl-β-D-maltoside or Triton X-100) are typically required when working with purified protein.

  • Functional assays: For channel activity studies, reconstitution into liposomes or expression in cell systems like Xenopus oocytes may be necessary, similar to approaches used for other connexins .

Based on experimental approaches with related connexins, researchers should perform initial characterization using Western blotting to confirm protein integrity and size, followed by functional assays appropriate to their specific research questions.

What are the most effective expression systems for studying Micropogonias undulatus Cx32.2 protein function?

For functional studies of Micropogonias undulatus Cx32.2 protein, several expression systems offer distinct advantages:

  • Xenopus oocyte expression system: This system has been successfully used for functional characterization of connexins including Cx26 and Cx32, making it likely suitable for Cx32.2 studies . The Xenopus system allows for controlled expression through cRNA injection and permits electrophysiological measurements of gap junction conductance under various voltage conditions.

  • Mammalian cell lines: Cell lines with minimal endogenous connexin expression (such as HeLa or N2A cells) provide a mammalian cellular environment for studying gap junction formation, trafficking, and function. These systems are valuable for investigating protein-protein interactions and subcellular localization.

  • Bacterial expression systems: E. coli has been demonstrated as an effective system for producing recombinant Micropogonias undulatus Cx32.2 protein with His-tagging for purification purposes . While bacterial systems may not support all post-translational modifications, they yield sufficient protein for structural studies and antibody production.

For the most comprehensive analysis, researchers should consider:

  • Using antisense oligonucleotides to suppress endogenous connexin expression in their chosen model system, similar to techniques used in previous connexin studies

  • Implementing tagged constructs (e.g., fluorescent proteins or epitope tags) for tracking protein localization

  • Combining multiple expression systems to validate findings across different cellular contexts

How can electrophysiological techniques be optimized for characterizing Cx32.2 channel properties?

Optimizing electrophysiological characterization of Micropogonias undulatus Cx32.2 channels requires careful experimental design:

  • Dual whole-cell voltage clamp: This technique, particularly in Xenopus oocytes, allows precise measurement of junctional conductance (gj) in response to both transjunctional potentials (Vj) and transmembrane potentials (Vi-o) . For Cx32.2, researchers should systematically apply voltage steps of varying amplitude and polarity to detect both fast and slow gating responses.

  • Voltage protocols: Based on findings from related connexins, protocols should include:

    • Paired pulses to test for voltage-dependent gating

    • Long-duration voltage steps (>5 seconds) to capture slow gating mechanisms

    • Symmetrical voltage applications to assess conductance changes with both positive and negative potentials

  • Control experiments:

    • Expression of antisense oligonucleotides against endogenous connexins to eliminate background coupling

    • Pharmacological gap junction blockers (e.g., heptanol, octanol) as negative controls

    • Parallel experiments with well-characterized connexins (e.g., mammalian Cx32) for comparison

  • Environmental parameters:

    • Testing channel properties at various pH levels

    • Examining calcium sensitivity of channel gating

    • Evaluating effects of phosphorylation by activating or inhibiting protein kinases

When designing these experiments, researchers should account for the potential dual gating mechanisms (fast and slow) observed in other connexins and establish baseline characteristics before investigating specific regulatory factors .

What fluorescence-based techniques are suitable for studying Cx32.2 localization and trafficking?

Several fluorescence-based techniques are suitable for investigating Micropogonias undulatus Cx32.2 localization and trafficking:

  • Fluorescence in situ hybridization (FISH): For detecting Cx32.2 mRNA expression patterns, FISH provides valuable spatial information. Two approaches are particularly relevant:

    • Standard FISH protocol: Using multiple, singly labeled oligonucleotide probes to detect individual Cx32.2 mRNA molecules, allowing subcellular localization and absolute quantification in individual cells

    • ECHOâFISH: A rapid 25-minute protocol using exciton-controlled hybridization-sensitive fluorescent oligonucleotide probes, which eliminates stringency washing steps while maintaining high specificity

  • Immunofluorescence microscopy: Using specific antibodies against Cx32.2 or epitope tags for visualizing protein localization in fixed cells

  • Live-cell imaging with fluorescent protein fusions: Creating Cx32.2 constructs with fluorescent protein tags (e.g., GFP, mCherry) to monitor trafficking and gap junction plaque formation in real-time

  • FRAP (Fluorescence Recovery After Photobleaching): For studying gap junction dynamics and protein mobility within plaques

  • Super-resolution microscopy techniques (STORM, PALM, or STED): To achieve nanoscale resolution of gap junction structure and organization beyond the diffraction limit of conventional microscopy

When implementing these approaches, researchers should validate findings across multiple techniques and include appropriate controls, such as known connexin localization patterns for comparison.

How can heterotypic gap junctions containing Cx32.2 be studied to understand their asymmetric properties?

Studying the asymmetric properties of heterotypic gap junctions containing Micropogonias undulatus Cx32.2 requires specialized experimental approaches:

  • Co-expression systems: Based on methodologies used for other connexins, researchers should:

    • Co-express Cx32.2 with other connexin family members in cell systems with minimal endogenous connexin expression

    • Use the Xenopus oocyte system with controlled expression of each connexin in separate oocytes that are then paired

    • Employ molecular tagging strategies to distinguish between the two connexin types

  • Electrophysiological characterization:

    • Apply voltage steps of opposite polarities to detect rectification and asymmetric voltage gating

    • Measure conductance changes in response to transjunctional potentials (Vj) in both directions

    • Analyze both fast and slow gating responses, as heterotypic junctions between Cx26 and Cx32 show distinct temporal components of voltage dependence

  • Analytical approaches:

    • Develop mathematical models to describe the asymmetric voltage-gating behavior

    • Compare experimental data with predicted behavior based on properties of homotypic junctions

    • Extract hemichannel gating parameters to understand how properties change in heterotypic configurations

  • Visualization techniques:

    • Use differentially tagged connexins to visualize the distribution within gap junction plaques

    • Apply correlative light and electron microscopy to link functional properties with structural organization

Drawing from studies of Cx26/Cx32 heterotypic junctions, researchers should specifically test whether Cx32.2-containing heterotypic junctions exhibit greater fast conductance changes dependent on transjunctional potential, with asymmetric responses based on the polarity of Vj .

What methodologies are recommended for investigating the molecular determinants of Cx32.2 voltage gating?

Investigating the molecular determinants of Micropogonias undulatus Cx32.2 voltage gating requires systematic structure-function analyses:

  • Site-directed mutagenesis: Based on knowledge from other connexins, researchers should target:

    • Charged residues in the N-terminus, which are critical for voltage sensing

    • Conserved proline residues in the second transmembrane domain

    • Cytoplasmic loop regions that influence slow gating mechanisms

    • Extracellular loop domains that participate in docking interactions

  • Chimeric protein approaches:

    • Create chimeras between Cx32.2 and connexins with different gating properties

    • Systematically swap domains to identify regions responsible for both fast and slow voltage-dependent gating

    • Test chimeras in expression systems like Xenopus oocytes that allow precise measurement of gap junction conductance

  • Computational modeling:

    • Perform molecular dynamics simulations of Cx32.2 hemichannels under various voltage conditions

    • Model charge interactions during voltage sensing

    • Predict conformational changes associated with channel gating

  • Correlation with other connexin data:

    • Compare voltage-gating properties with those established for mammalian Cx32

    • Identify unique features of Cx32.2 that may relate to its function in Micropogonias undulatus

    • Investigate whether the dual gating mechanism (dependence on both Vj and Vi-o) observed in some connexins is present in Cx32.2

These methodologies should be applied systematically, with mutational effects quantified through standardized electrophysiological protocols that measure both the fast and slow components of voltage-dependent gating.

What advanced analytical techniques can resolve contradictory findings in Cx32.2 research?

Resolving contradictory findings in Cx32.2 research requires sophisticated analytical approaches:

  • Meta-analysis strategies:

    • Systematically compare experimental conditions across studies

    • Identify variables that may account for discrepancies (e.g., expression systems, recording solutions, voltage protocols)

    • Apply statistical methods to determine if contradictions are significant or within experimental variation

  • Multiple complementary techniques:

    • Combine electrophysiological, biochemical, and imaging approaches

    • Verify protein expression and proper membrane targeting before interpreting functional data

    • Use both in vitro and cell-based assays to triangulate findings

  • Single-molecule approaches:

    • Implement single-channel recordings to resolve heterogeneity in channel populations

    • Apply optical techniques that can detect conformational changes in individual protein molecules

    • Use high-resolution imaging, such as atomic force microscopy, to connect structural and functional data

  • Rigorous controls:

    • Include parallel experiments with well-characterized connexins

    • Test antibody specificity against recombinant protein standards

    • Validate expression constructs through sequencing and Western blotting

  • Collaborative validation:

    • Establish multi-laboratory protocols for standardized Cx32.2 characterization

    • Share key reagents and constructs to minimize technical variability

    • Implement blinded analysis of data to reduce experimenter bias

When contradictory findings emerge, researchers should particularly focus on whether discrepancies relate to fundamental properties of the protein or to context-dependent behaviors that may reveal important regulatory mechanisms.

How does Micropogonias undulatus Cx32.2 compare with mammalian Cx32 in structure and function?

Comparative analysis of Micropogonias undulatus Cx32.2 and mammalian Cx32 reveals important similarities and differences:

  • Structural comparison:

    • Both proteins belong to the connexin family, which forms gap junction channels composed of hexameric hemichannels (connexons)

    • Micropogonias undulatus Cx32.2 has a full mature protein length spanning amino acids 2-285 , which is similar to the approximately 283 amino acids of mammalian Cx32

    • Both likely share the typical connexin topology with four transmembrane domains, two extracellular loops, and cytoplasmic N- and C-termini

  • Functional properties:

    • Mammalian Cx32 exhibits a slow dependence on transjunctional voltage (Vj) but no dependence on transmembrane potential (Vi-o)

    • While specific electrophysiological data for Micropogonias undulatus Cx32.2 is not detailed in the search results, the ".2" designation suggests it may be a paralog with potentially distinct functional properties

    • Both proteins likely form functional gap junction channels that allow the passage of small molecules and ions between cells

  • Evolutionary considerations:

    • The presence of Cx32-like proteins across different vertebrate species (from fish to mammals) indicates evolutionary conservation of this connexin type

    • Fish-specific connexin duplications or divergence may have led to specialized functions of Cx32.2 in Micropogonias undulatus

    • Comparative studies may reveal adaptation of gap junction proteins to different cellular environments or physiological requirements

For researchers conducting comparative studies, it is important to note that while the core channel-forming functions are likely conserved, species-specific differences in regulatory domains (particularly the C-terminus) may lead to distinct responses to phosphorylation, pH sensitivity, or protein-protein interactions.

What evolutionary insights can be gained from studying fish connexins like Cx32.2?

Studying fish connexins like Micropogonias undulatus Cx32.2 provides valuable evolutionary insights:

  • Connexin family evolution:

    • Fish connexins represent evolutionarily earlier versions of vertebrate gap junction proteins

    • Comparison between fish and mammalian connexins reveals conserved functional domains versus rapidly evolving regulatory regions

    • Fish-specific connexin paralogs may illuminate the evolutionary trajectory of the gene family following whole-genome duplication events in teleost evolution

  • Functional adaptation:

    • Fish connexins may show adaptations to aquatic environments, such as temperature sensitivity, pressure tolerance, or ion selectivity

    • Specialized functions in fish tissues might reveal ancestral roles of connexins that have been modified or lost in terrestrial vertebrates

    • Comparative studies can identify whether voltage-gating properties of connexins (like the dual fast and slow mechanisms) represent ancient or derived features

  • Methodological approaches:

    • Cross-species hybridization experiments similar to those performed with other fish species can test functional compatibility between evolutionarily distant connexins

    • Phylogenetic analysis coupled with functional characterization can map the acquisition of specific properties onto the evolutionary tree

    • Genomic analysis of connexin gene clusters can reveal patterns of duplication, loss, and diversification

  • Applications to human health:

    • Understanding the evolution of connexin structure-function relationships may provide insights into human connexin-related diseases

    • Fish models may reveal compensatory mechanisms for connexin dysfunction that could inform therapeutic approaches

    • Evolutionary constraints identified in fish connexins may highlight structurally critical regions that cannot tolerate mutations

These evolutionary studies not only contribute to our understanding of gap junction biology but also provide context for interpreting the significance of sequence variations in human connexin-related disorders.

What are the common challenges in purifying functional recombinant Cx32.2 protein and how can they be addressed?

Purifying functional recombinant Micropogonias undulatus Cx32.2 protein presents several challenges that researchers can address with specific strategies:

  • Protein solubility issues:

    • Challenge: As a membrane protein with multiple transmembrane domains, Cx32.2 may form insoluble aggregates during expression.

    • Solution: Optimize expression conditions (temperature, induction time), use specialized E. coli strains designed for membrane proteins, and employ fusion tags that enhance solubility (e.g., MBP, SUMO) in addition to the His-tag used for purification .

  • Maintaining native conformation:

    • Challenge: Ensuring that purified Cx32.2 retains its native structure and function.

    • Solution: Use mild detergents (DDM, CHAPS) during purification, consider nanodiscs or amphipols for final protein storage, and validate protein folding through circular dichroism or limited proteolysis assays.

  • Low expression yield:

    • Challenge: Gap junction proteins often express at low levels in heterologous systems.

    • Solution: Optimize codon usage for the expression host, use strong inducible promoters, and consider baculovirus expression systems as alternatives to E. coli when higher yields are required.

  • Protein homogeneity:

    • Challenge: Obtaining homogeneous protein preparations suitable for structural or functional studies.

    • Solution: Implement multi-step purification strategies combining affinity chromatography with size exclusion and ion exchange techniques, and use analytical ultracentrifugation to verify homogeneity.

  • Functional validation:

    • Challenge: Confirming that purified Cx32.2 retains channel-forming capabilities.

    • Solution: Develop liposome reconstitution assays, employ planar lipid bilayer electrophysiology, and use fluorescent dye transfer assays to verify channel function after purification.

Researchers working with recombinant Micropogonias undulatus Cx32.2 protein should systematically optimize each purification step while continuously monitoring protein quality through functional and structural assessments.

What quality control measures are essential when working with recombinant Cx32.2 protein?

Essential quality control measures for recombinant Micropogonias undulatus Cx32.2 protein include:

  • Protein identity and integrity verification:

    • SDS-PAGE and Western blotting with specific antibodies against Cx32.2 or tag epitopes

    • Mass spectrometry analysis to confirm protein sequence and identify any post-translational modifications

    • N-terminal sequencing to verify correct processing of the protein

  • Purity assessment:

    • High-resolution gel electrophoresis with densitometry analysis to quantify purity percentage

    • Size exclusion chromatography to detect aggregates or degradation products

    • Dynamic light scattering to assess sample homogeneity and detect aggregation

  • Structural validation:

    • Circular dichroism spectroscopy to verify secondary structure content consistent with connexin proteins

    • Thermal shift assays to assess protein stability under various buffer conditions

    • Limited proteolysis patterns to confirm proper folding

  • Functional characterization:

    • Liposome dye transfer assays to verify channel-forming ability

    • Electrophysiological measurements in reconstituted systems

    • Binding assays for known connexin-interacting partners

  • Batch consistency:

    • Standardized expression and purification protocols with defined acceptance criteria

    • Reference standards from validated batches for comparative analysis

    • Stability testing under various storage conditions to determine optimal handling procedures

  • Documentation requirements:

    • Detailed records of expression conditions, purification steps, and buffer compositions

    • Quantitative metrics for each quality control parameter with defined acceptable ranges

    • Certificate of analysis for each batch indicating test results for all quality parameters

Implementing these quality control measures ensures that experimental results with recombinant Cx32.2 protein are reliable and reproducible across different studies and laboratories.

How can researchers troubleshoot inconsistent results in Cx32.2 functional assays?

When encountering inconsistent results in Micropogonias undulatus Cx32.2 functional assays, researchers should implement the following troubleshooting approaches:

  • Expression system variables:

    • Problem: Variability in protein expression levels affecting functional outcomes.

    • Solution: Quantify protein expression in each experiment using Western blotting or fluorescence measurements; normalize functional data to expression levels; and consider stable cell lines for more consistent expression.

  • Technical execution:

    • Problem: Variations in experimental technique introducing artifactual results.

    • Solution: Develop detailed standard operating procedures (SOPs); implement automated systems where possible to reduce operator variability; and conduct blind analysis of results to minimize bias.

  • Assay sensitivity and specificity:

    • Problem: Functional assays not optimally designed for Cx32.2 properties.

    • Solution: Validate assays with positive controls (known connexins with well-characterized properties); establish dose-response relationships for known gap junction modulators; and determine the dynamic range and detection limits of each assay.

  • Environmental factors:

    • Problem: Uncontrolled variables affecting channel function.

    • Solution: Strictly control temperature, pH, and ionic composition; document and standardize time between sample preparation and measurement; and minimize exposure to oxidizing conditions that could affect cysteine residues.

  • Protein modification states:

    • Problem: Post-translational modifications altering channel properties.

    • Solution: Analyze phosphorylation state using phospho-specific antibodies or mass spectrometry; test effects of phosphatase or kinase inhibitors; and consider using phosphomimetic mutations to produce homogeneous protein states.

  • Systematic validation approach:

    • Problem: Inability to determine the source of variability.

    • Solution: Implement a systematic matrix of conditions to identify critical variables; replicate key experiments in different laboratory settings; and compare results with computational predictions based on structural models.

For electrophysiological studies specifically, researchers should consider:

  • Standardizing electrode properties and access resistance criteria

  • Establishing consistent voltage protocols based on findings from other connexins

  • Implementing automated analysis pipelines to reduce subjective interpretation of traces

What are the emerging techniques for studying protein-protein interactions involving Cx32.2?

Several cutting-edge techniques are emerging for investigating protein-protein interactions involving Micropogonias undulatus Cx32.2:

  • Proximity-based labeling approaches:

    • BioID or TurboID fusion constructs with Cx32.2 to identify proteins in the vicinity of gap junctions under native conditions

    • APEX2 tagging for electron microscopy visualization of interaction partners with nanometer resolution

    • Split-BioID systems to detect specific interaction interfaces within multiprotein complexes

  • Advanced microscopy techniques:

    • Single-molecule FRET to detect conformational changes during protein binding events

    • Super-resolution microscopy (STORM, PALM) to visualize protein clusters at gap junction plaques with 10-20 nm resolution

    • Lattice light-sheet microscopy for long-term imaging of interaction dynamics with minimal phototoxicity

  • Functional proteomics:

    • Crosslinking mass spectrometry (XL-MS) to map interaction interfaces at amino acid resolution

    • Thermal proteome profiling to detect changes in protein complex stability upon ligand binding

    • Quantitative interactomics with SILAC or TMT labeling to identify dynamic changes in interaction networks

  • Genetic approaches:

    • CRISPR-based screening for functional interaction partners

    • Synthetic genetic array analysis to identify genetic interactions

    • Split protein complementation assays optimized for membrane protein interactions

  • Computational methods:

    • Molecular docking simulations to predict interaction interfaces

    • Coevolution analysis to identify co-varying residues likely involved in protein-protein interactions

    • Network analysis of connexin interactomes to identify common binding partners across connexin family members

These emerging techniques not only help identify novel interaction partners but also provide mechanistic insights into how these interactions regulate Cx32.2 trafficking, channel assembly, and gating properties.

How can researchers investigate the tissue-specific functions of Cx32.2 in Micropogonias undulatus?

Investigating tissue-specific functions of Cx32.2 in Micropogonias undulatus (Atlantic croaker) requires specialized approaches for this marine species:

  • Expression profiling techniques:

    • RNA analysis: Implement tissue-specific transcriptomics using RNA-Seq or qPCR to quantify Cx32.2 expression across different organs and developmental stages

    • Protein localization: Develop specific antibodies against Micropogonias undulatus Cx32.2 for immunohistochemistry and Western blotting

    • In situ hybridization: Apply FISH techniques to visualize mRNA distribution at the cellular level across tissues

  • Functional studies in native tissues:

    • Ex vivo preparations: Develop tissue slice preparations that maintain gap junctional coupling

    • Dye transfer assays: Use gap junction-permeable fluorescent dyes to assess functional coupling between cells

    • Electrophysiological recording: Implement dual-cell patch-clamp techniques in freshly isolated cell pairs from relevant tissues

  • Gene manipulation approaches:

    • Morpholino or siRNA knockdown: For transient suppression of Cx32.2 expression in early developmental stages

    • CRISPR/Cas9 genome editing: Establish protocols for genetic modification in Micropogonias undulatus

    • Transgenic approaches: Develop tissue-specific promoters for expressing modified Cx32.2 proteins

  • Comparative studies:

    • Cross-species analyses: Compare Cx32.2 function with mammalian Cx32 in equivalent tissues

    • Ecological correlations: Investigate whether Cx32.2 expression or function correlates with specific environmental adaptations or behaviors

    • Evolutionary considerations: Examine paralogs and orthologs across fish species to identify conserved tissue-specific functions

  • Systems-level analysis:

    • Proteomics: Identify tissue-specific interaction partners that may regulate Cx32.2 function

    • Metabolomics: Analyze how gap junctional communication affects metabolite distribution in different tissues

    • Physiological measurements: Correlate Cx32.2 function with tissue-specific physiological parameters

These approaches can be integrated to build a comprehensive understanding of how Cx32.2 contributes to tissue-specific functions in the Atlantic croaker, potentially revealing specialized roles in this marine species compared to other vertebrates.

What research directions might lead to novel applications of Cx32.2 in biomedical research?

Several promising research directions could lead to novel applications of Micropogonias undulatus Cx32.2 in biomedical research:

  • Comparative connexin biology:

    • Systematic comparison between fish and mammalian connexins could reveal evolutionary adaptations relevant to gap junction channel regulation

    • Identification of unique properties in Cx32.2 might inform the design of connexin-targeted therapeutics for human diseases

    • Understanding species-specific differences in voltage gating and pH sensitivity could provide insights into fundamental mechanisms of channel regulation

  • Bioengineering applications:

    • Development of chimeric connexins incorporating specific domains from Cx32.2 with altered gating or permeability properties

    • Creation of engineered tissues with controlled intercellular communication using modified Cx32.2 channels

    • Design of biosensors based on Cx32.2 hemichannels that respond to specific environmental stimuli

  • Models for connexin-related disorders:

    • Using the unique properties of Cx32.2 to develop improved model systems for human connexin-related diseases

    • Investigating whether Cx32.2 can functionally replace mammalian Cx32 in cases where the latter is mutated (as in X-linked Charcot-Marie-Tooth disease)

    • Exploring compensatory mechanisms that might exist in fish connexin networks that could inform therapeutic approaches

  • Drug discovery platforms:

    • Screening for compounds that specifically modulate Cx32.2 function could identify lead molecules for developing gap junction modulators

    • Using heterotypic Cx32.2-containing channels as models to study drugs targeting asymmetric gap junctions

    • Developing high-throughput assays based on Cx32.2 function for screening chemical libraries

  • Tissue engineering and regenerative medicine:

    • Exploiting potential unique properties of Cx32.2 (such as temperature sensitivity or ion selectivity) for controlled cell-cell communication in engineered tissues

    • Investigating whether fish connexins like Cx32.2 confer advantages in certain environmental conditions that could be applied to tissue preservation

These research directions not only expand our understanding of connexin biology across species but also leverage the unique properties of Micropogonias undulatus Cx32.2 for innovative biomedical applications.

What novel imaging techniques are most promising for visualizing Cx32.2 dynamics in living cells?

Several innovative imaging techniques show particular promise for visualizing Micropogonias undulatus Cx32.2 dynamics in living cells:

  • Super-resolution microscopy approaches:

    • STED (Stimulated Emission Depletion) microscopy: Achieves resolution down to 20-30 nm, allowing visualization of individual gap junction plaques and their dynamic assembly

    • PALM/STORM: Single-molecule localization microscopy techniques that can resolve the substructure of gap junction plaques and track individual Cx32.2 molecules

    • SIM (Structured Illumination Microscopy): Offers improved resolution (approximately 100 nm) with relatively low phototoxicity, suitable for longer-term live imaging

  • Advanced live-cell imaging strategies:

    • Lattice light-sheet microscopy: Combines high spatiotemporal resolution with minimal phototoxicity, ideal for tracking Cx32.2 trafficking over extended periods

    • Single-particle tracking: Using quantum dots or photoactivatable fluorescent proteins to follow individual Cx32.2 molecules from synthesis to incorporation into gap junctions

    • Fluorescence fluctuation spectroscopy: Techniques like Number and Brightness (N&B) analysis that can measure oligomerization states of Cx32.2 in living cells

  • Functional imaging approaches:

    • FRET-based sensors: Developing connexin constructs with strategically placed fluorophores to detect conformational changes during channel gating

    • pH-sensitive GFP variants: To visualize local pH changes associated with gap junction channel activity

    • Calcium imaging: Combined with optogenetic tools to correlate Cx32.2 function with calcium signaling between cells

  • Correlative techniques:

    • CLEM (Correlative Light and Electron Microscopy): Linking fluorescence observations of Cx32.2 dynamics with ultrastructural analysis

    • Live-to-fixed imaging: Capturing dynamic events in living cells followed by super-resolution imaging of the same structures after fixation

    • Correlative cryo-fluorescence and cryo-electron microscopy: Preserving native structures for high-resolution analysis

  • Emerging technologies:

    • Expansion microscopy: Physical enlargement of specimens to achieve super-resolution images on conventional microscopes

    • Label-free imaging methods: Techniques such as transient absorption microscopy that can detect proteins without fluorescent tagging

    • Adaptive optics: Correction of optical aberrations to improve imaging depth and resolution in complex samples

These advanced imaging approaches, when applied to Cx32.2 studies, can provide unprecedented insights into gap junction assembly, remodeling, and gating dynamics in living systems.

What are the most effective strategies for studying the regulation of Cx32.2 by post-translational modifications?

Effective strategies for studying post-translational modifications (PTMs) of Micropogonias undulatus Cx32.2 include:

  • Mass spectrometry-based approaches:

    • Global PTM profiling: Shotgun proteomics with enrichment strategies for phosphorylation, ubiquitination, SUMOylation, and other modifications

    • Targeted MS: Multiple reaction monitoring (MRM) or parallel reaction monitoring (PRM) for quantifying specific modified peptides

    • Top-down proteomics: Analysis of intact Cx32.2 protein to preserve modification patterns and identify combinatorial PTMs

  • Site-specific mutagenesis strategies:

    • Phosphomimetic mutations: Replacing potentially phosphorylated residues with aspartate or glutamate to mimic constitutive phosphorylation

    • Phospho-dead mutations: Converting potential phosphorylation sites to alanine to prevent modification

    • Systematic mutational scanning: Creating a library of single-site mutants to identify functionally important modification sites

  • Real-time monitoring of modification dynamics:

    • FRET-based biosensors: Designing constructs that undergo conformational changes upon modification

    • Antibody-based approaches: Using phospho-specific antibodies in combination with proximity ligation assays

    • Click chemistry: Metabolic labeling with modified amino acids or PTM precursors for tracking modification dynamics

  • Manipulation of cellular signaling:

    • Pharmacological interventions: Using kinase or phosphatase inhibitors to alter modification states

    • Optogenetic control: Light-activated kinases or phosphatases for spatiotemporal control of modifications

    • Inducible expression systems: Controlled activation of signaling pathways that regulate Cx32.2 modifications

  • Functional correlation studies:

    • Electrophysiological measurement: Correlating channel properties with modification states

    • Trafficking analysis: Examining how PTMs affect Cx32.2 movement through the secretory pathway

    • Protein-protein interaction mapping: Identifying how modifications alter the Cx32.2 interactome

These approaches should be integrated into a comprehensive workflow that connects the presence of specific modifications with functional outcomes in terms of Cx32.2 channel properties, trafficking, and protein-protein interactions.

What bioinformatics tools are most valuable for analyzing Cx32.2 structure-function relationships?

Several bioinformatics tools and computational approaches are particularly valuable for analyzing Micropogonias undulatus Cx32.2 structure-function relationships:

  • Structural prediction and analysis tools:

    • AlphaFold2/RoseTTAFold: State-of-the-art protein structure prediction algorithms that can generate highly accurate models of Cx32.2 structure

    • Molecular dynamics simulations: For modeling conformational changes during channel gating, especially in response to voltage changes

    • Homology modeling: Using known connexin structures (e.g., Cx26) as templates for modeling Cx32.2-specific features

    • Protein-protein docking: Predicting interactions between Cx32.2 hemichannels and with regulatory partners

  • Sequence analysis platforms:

    • Multi-species connexin alignment tools: For identifying conserved functional domains and species-specific variations

    • Evolutionary trace analysis: Mapping functionally important residues based on evolutionary conservation patterns

    • PTM prediction algorithms: Tools like NetPhos, UbPred, or SUMOplot for predicting modification sites

    • Transmembrane topology prediction: Programs like TMHMM or Phobius for validating membrane-spanning regions

  • Network and systems biology approaches:

    • Protein interaction network analysis: Tools like STRING or Cytoscape for mapping the Cx32.2 interactome

    • Pathway enrichment analysis: Identifying signaling pathways that interact with Cx32.2

    • Coexpression analysis: Finding genes with expression patterns correlated with Cx32.2 across tissues

    • Genetic association analysis: Correlating genetic variations with functional outcomes in fish populations

  • Functional prediction algorithms:

    • Ion channel selectivity prediction: Computational tools for predicting channel properties based on pore-lining residues

    • Voltage sensor prediction: Identifying potential voltage-sensing domains that respond to membrane potential changes

    • Stability analysis: Tools like FoldX for predicting how mutations affect protein stability and assembly

  • Data integration platforms:

    • Knowledge graph approaches: Connecting disparate data types (genomic, proteomic, electrophysiological) into unified models

    • Comparative genomics databases: Resources for placing Cx32.2 in evolutionary context

    • Visual analytics tools: For integrating structural data with functional measurements and evolutionary information

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.