Recombinant Microtus pennsylvanicus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Microtus pennsylvanicus (Meadow vole)
Target Names
Target Protein Sequence
MAYPFQLGLQDASSPIMEELMNFHDHTLMIVFLISSLVLYIITLMLTTKLTHTSTMDAQE VETIWTILPAVILILIALPSLRILYMMDEINNPALTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATISSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKNFEDWSLSMI
Uniprot No.

Target Background

Function

Recombinant Microtus pennsylvanicus Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme complex drives oxidative phosphorylation, a critical process for energy production. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (CIV). These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen. This electron transfer generates an electrochemical gradient across the inner mitochondrial membrane, powering transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) comprising heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Microtus pennsylvanicus Cytochrome c oxidase subunit 2 (MT-CO2)?

Microtus pennsylvanicus Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrial protein encoded by the mitochondrial genome (mtDNA) in meadow voles (Microtus pennsylvanicus). It functions as one of the core components of the cytochrome c oxidase complex (Complex IV) in the electron transport chain, which is essential for cellular respiration. The protein is 227 amino acids in length and plays a crucial role in mitochondrial energy production by catalyzing the reduction of oxygen to water, coupled with proton pumping across the inner mitochondrial membrane .

The recombinant form is typically produced with a histidine tag for purification purposes and is used in various research applications including evolutionary studies, functional analyses, and as controls in diagnostic assays for mitochondrial disorders .

How should recombinant MT-CO2 protein be properly stored and reconstituted?

Proper storage and reconstitution of recombinant MT-CO2 protein is critical for maintaining its structural integrity and functional activity. Based on established protocols, the following methodology is recommended:

Storage Conditions:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

This methodology maximizes protein stability while minimizing degradation. Repeated freeze-thaw cycles should be avoided as they can significantly reduce protein activity and integrity through denaturation and aggregation.

What expression systems are most effective for producing functional MT-CO2?

The selection of an appropriate expression system is crucial for obtaining functional recombinant MT-CO2 protein. While E. coli is commonly used, researchers should consider several factors when selecting an expression system:

Expression SystemAdvantagesLimitationsApplications
E. coli- High yield
- Cost-effective
- Rapid production
- Easily scalable
- Limited post-translational modifications
- Potential for inclusion body formation
- Potential endotoxin contamination
- Structural studies
- Antibody production
- Protein-protein interaction assays
Yeast (S. cerevisiae/P. pastoris)- Some post-translational modifications
- Higher protein folding accuracy
- Secretion capability
- Lower yields than E. coli
- Longer production time
- Hyperglycosylation
- Functional studies requiring proper folding
- Applications sensitive to bacterial contaminants
Mammalian cells- Native post-translational modifications
- Proper protein folding
- Natural cellular environment
- Expensive
- Labor-intensive
- Lower yields
- Functional assays
- Studies of protein interactions within mammalian context

How can I verify the purity and activity of recombinant MT-CO2 protein in my experiments?

Verifying both purity and activity is essential when working with recombinant MT-CO2. A multi-method approach is recommended:

Purity Assessment:

  • SDS-PAGE analysis with Coomassie or silver staining (expected purity >90%)

  • Western blotting using anti-His antibodies or MT-CO2-specific antibodies

  • Size-exclusion chromatography to detect aggregates or degradation products

  • Mass spectrometry for precise molecular weight determination and identification of potential contaminants

Activity Verification:

  • Cytochrome c oxidase activity assay measuring oxygen consumption or electron transfer rates

  • Spectrophotometric analysis of reduced cytochrome c oxidation

  • Protein-protein interaction assays with known binding partners

  • Integration into liposomes or isolated mitochondria to assess functional membrane incorporation

Combining these methodologies provides a comprehensive assessment of both protein quality and functionality, ensuring reliable experimental results. For MT-CO2 specifically, researchers should be aware that proper folding and incorporation into phospholipid membranes may be necessary for full activity assessment.

What are the challenges in studying MT-CO2 variants in phylogenetic analyses?

Studying MT-CO2 variants in phylogenetic analyses presents several methodological challenges that researchers should address:

  • Incomplete lineage sorting: MT-CO2 sequences may not form reciprocal clades even between well-established species (as observed between M. ochrogaster and M. pennsylvanicus) . This necessitates multi-locus approaches combining both mitochondrial and nuclear markers for accurate phylogenetic reconstruction.

  • Heteroplasmy detection: Multiple MT-CO2 variants may coexist within the same individual or tissue at different frequencies. Quantitative methods such as pyrosequencing are essential for accurate determination of heteroplasmy levels, with reliable detection thresholds of >3% .

  • Tissue-specific variation: MT-CO2 variant frequencies may differ across tissues. Comprehensive sampling from multiple tissues (muscle, blood, urinary sediments, and buccal epithelia) provides a more complete picture of variant distribution .

  • Hybridization and introgression: In closely related species like Microtus, hybridization can complicate phylogenetic analyses. Single-locus studies may not accurately reflect species relationships due to mitochondrial introgression .

For addressing these challenges, a multi-faceted approach combining molecular data with morphometric analyses can help disentangle complex evolutionary relationships, as demonstrated in recent studies of Microtus species .

How can single-fiber segregation studies be designed to determine pathogenicity of novel MT-CO2 variants?

Single-fiber segregation studies represent a powerful approach for establishing pathogenicity of novel MT-CO2 variants, particularly when multiple variants co-occur. The following methodology has proven effective in clinical research settings:

Experimental Design:

  • Muscle Biopsy Sampling: Obtain skeletal muscle biopsies from affected individuals and, when possible, unaffected maternal relatives for comparison .

  • Histochemical Staining: Perform sequential cytochrome c oxidase (COX) and succinate dehydrogenase (SDH) histochemistry to identify COX-deficient and COX-positive fibers .

  • Laser-Capture Microdissection (LCM): Isolate individual muscle fibers (both COX-deficient and COX-normal) using LCM technology to obtain pure populations of fibers with varying mitochondrial function .

  • Quantitative Variant Analysis: Analyze heteroplasmy levels in individual fibers using quantitative methods such as pyrosequencing or digital PCR. Design variant-specific primers for accurate quantification with detection sensitivity >3% .

  • Correlation Analysis: Establish statistical correlation between variant load and biochemical phenotype (COX-deficiency) across multiple individual fibers.

Interpretation Framework:

  • Pathogenic variants typically show higher heteroplasmy levels in COX-deficient fibers compared to COX-positive fibers

  • Establish threshold effect by identifying the heteroplasmy level at which biochemical defects manifest

  • Compare segregation patterns across multiple variants when present

  • Analyze familial segregation by examining variant distribution in maternal relatives

This approach has successfully differentiated pathogenic from non-pathogenic MT-CO2 variants in clinical cases, as demonstrated in a recent study where segregation analysis revealed m.7887G>A p.(Gly101Asp) as the causative variant among multiple heteroplasmic MT-CO2 variants .

What methodologies can be employed to study the functional impact of MT-CO2 variants on mitochondrial respiration?

Investigating the functional consequences of MT-CO2 variants requires a multi-level experimental approach:

Cellular Bioenergetic Analysis:

  • Oxygen Consumption Measurements: Use high-resolution respirometry or Seahorse XF analyzers to quantify basal, maximal, and reserve respiratory capacity in cells harboring MT-CO2 variants.

  • Complex IV Activity Assays: Measure cytochrome c oxidase activity in isolated mitochondria or permeabilized cells using spectrophotometric methods to directly assess the impact of variants on enzyme function.

  • Mitochondrial Membrane Potential: Assess using potentiometric dyes (TMRM, JC-1) to determine if variants affect proton pumping capacity.

Molecular and Structural Assessments:

  • Blue Native PAGE: Analyze assembly of respiratory chain supercomplexes to determine if variants affect the integration of Complex IV into higher-order structures.

  • Protein Stability Analysis: Use thermal shift assays or limited proteolysis to assess whether variants affect MT-CO2 protein stability.

  • Molecular Modeling: Generate in silico structural models to predict the impact of amino acid substitutions on protein folding, subunit interactions, or catalytic sites.

Genetic Complementation:

  • Cybrid Technology: Generate transmitochondrial cybrid cell lines by fusing ρ0 cells (depleted of mtDNA) with platelets or mitochondria containing the variant of interest.

  • Allotopic Expression: Express recombinant wild-type or variant MT-CO2 with mitochondrial targeting sequences to assess rescue of function in cells with MT-CO2 defects.

  • CRISPR/Cas9 Mitochondrial Base Editing: Apply emerging technologies for introducing specific mtDNA variants to establish causality through direct genetic manipulation.

This comprehensive approach enables researchers to establish clear genotype-phenotype correlations for MT-CO2 variants, which is particularly important in distinguishing pathogenic mutations from benign polymorphisms in both research and clinical contexts.

How does MT-CO2 from Microtus pennsylvanicus compare with other rodent species in evolutionary studies?

MT-CO2 serves as an important molecular marker in evolutionary studies of rodents, with Microtus pennsylvanicus providing valuable insights into recent radiations within the Cricetidae family:

Comparative Evolutionary Analysis:

  • Sequence Conservation: MT-CO2 from Microtus pennsylvanicus shows high conservation in catalytic domains but displays species-specific variations in less functionally constrained regions. These patterns of conservation versus variability provide insights into selective pressures on mitochondrial function throughout rodent evolution.

  • Incomplete Lineage Sorting: Phylogenetic analyses have revealed that MT-CO2 sequences from Microtus pennsylvanicus and Microtus ochrogaster do not always form reciprocal clades, suggesting recent divergence and/or hybridization between these species . This pattern is observed despite clear morphological differences between these species.

  • Multi-Marker Approach: Studies combining MT-CO2 with nuclear markers (such as von Willebrand factor gene (Vwf) and growth hormone receptor gene (Ghr)) provide more robust phylogenetic reconstructions than single-gene analyses . This integrative approach helps resolve the complex evolutionary history of rapid radiations within Microtus.

Methodological Framework for MT-CO2 Evolutionary Studies:

Analytical MethodApplicationKey Findings in Microtus Studies
Phylogenetic Analysis (ML/Bayesian)Reconstruction of evolutionary relationshipsIncomplete reciprocal monophyly between M. pennsylvanicus and M. ochrogaster
Selection Analysis (dN/dS ratios)Identification of selective pressuresPurifying selection on functional domains with variable constraints on other regions
Population Genetics (π, Tajima's D)Assessment of within-species variationEvidence of population expansion and selective sweeps in certain Microtus populations
Divergence DatingEstimation of speciation timingRecent and rapid radiation within the Microtus genus
Hybridization DetectionIdentification of gene flow between speciesLocalized hybridization potentially explaining incomplete lineage sorting

These evolutionary studies of MT-CO2 contribute to our understanding of speciation processes, particularly in recent radiations where morphological and genetic differentiation may be discordant. The integration of MT-CO2 sequence data with morphometric analyses and nuclear genetic markers provides a more complete picture of evolutionary relationships within the Cricetidae family .

What are the most effective protein purification strategies for recombinant MT-CO2?

Purification of recombinant MT-CO2 requires careful consideration of the protein's hydrophobic nature and structural complexity. The following stepwise methodology is recommended for optimal results:

Purification Strategy for His-Tagged MT-CO2:

  • Cell Lysis Optimization:

    • For E. coli expression systems, use mild detergents (0.5-1% n-dodecyl β-D-maltoside or CHAPS) in lysis buffers

    • Include protease inhibitors to prevent degradation

    • Consider membrane fractionation techniques for enrichment prior to affinity chromatography

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Use Ni-NTA or cobalt-based resins for His-tagged MT-CO2 capture

    • Optimize imidazole concentration in wash buffers (20-50 mM) to reduce non-specific binding

    • Elute with a gradient of imidazole (100-300 mM) for improved separation

  • Secondary Purification:

    • Size exclusion chromatography to remove aggregates and obtain monodisperse protein

    • Ion exchange chromatography as an orthogonal purification step

    • Consider lipid-based purification methods for maintaining native-like environment

  • Quality Control Assessments:

    • SDS-PAGE with Coomassie staining (aim for >90% purity)

    • Western blot verification with anti-His and anti-MT-CO2 antibodies

    • Mass spectrometry for confirmation of intact protein

For experiments requiring native protein conformation, additional considerations include maintaining an appropriate detergent concentration throughout the purification process and potentially incorporating phospholipids or nanodisc technology to stabilize the protein in a membrane-like environment.

How can recombinant MT-CO2 be used to develop diagnostic tools for mitochondrial disorders?

Recombinant MT-CO2 has significant potential for developing diagnostic tools for mitochondrial disorders, particularly those involving cytochrome c oxidase deficiency:

Diagnostic Applications:

  • Antibody Development and Validation:

    • Generate and validate antibodies against conserved MT-CO2 epitopes using purified recombinant protein

    • Develop immunohistochemical or immunofluorescence assays for tissue analysis

    • Create quantitative western blot protocols for patient sample analysis

  • Enzyme Activity Reference Standards:

    • Establish standardized cytochrome c oxidase activity assays using recombinant MT-CO2

    • Create calibration curves for quantitative assessment of patient samples

    • Develop quality control materials for clinical laboratories

  • Variant Pathogenicity Assessment:

    • Generate recombinant MT-CO2 proteins containing variants of unknown significance

    • Compare biochemical properties with wild-type protein

    • Establish functional thresholds for pathogenicity classification

  • Biomarker Development:

    • Identify MT-CO2-specific peptides for targeted proteomic assays

    • Develop mass spectrometry-based methods for quantifying MT-CO2 in complex samples

    • Create MT-CO2 variant-specific assays for heteroplasmy detection

These diagnostic applications address a critical need in mitochondrial medicine, where establishing the pathogenicity of novel variants remains challenging. As demonstrated in recent clinical research, muscle biopsy with subsequent molecular and histochemical analysis remains essential for definitive diagnosis of mitochondrial disorders, even in the era of next-generation sequencing . Recombinant MT-CO2 provides valuable reference material for these diagnostic workflows.

What methodologies can be used to study the interaction between MT-CO2 and other components of the respiratory chain?

Understanding the interactions between MT-CO2 and other respiratory chain components requires sophisticated methodological approaches that can capture both structural and functional aspects of these interactions:

Structural Interaction Analysis:

  • Crosslinking Mass Spectrometry (XL-MS):

    • Use chemical crosslinkers to capture transient protein-protein interactions

    • Analyze crosslinked peptides by MS/MS to identify interaction interfaces

    • Map interaction sites to structural models of respiratory complexes

  • Cryo-Electron Microscopy:

    • Visualize intact respiratory chain supercomplexes containing MT-CO2

    • Determine structural alterations induced by MT-CO2 variants

    • Analyze conformational changes associated with enzyme function

  • Förster Resonance Energy Transfer (FRET):

    • Label MT-CO2 and interacting partners with appropriate fluorophores

    • Measure energy transfer as indicator of protein proximity

    • Assess dynamic interactions in native-like membrane environments

Functional Interaction Analysis:

  • Blue Native PAGE with Activity Staining:

    • Separate intact respiratory complexes under non-denaturing conditions

    • Perform in-gel activity assays to correlate complex assembly with function

    • Compare wild-type and variant MT-CO2 incorporation into functional complexes

  • Respiratory Chain Supercomplex Formation:

    • Assess the role of MT-CO2 in mediating interactions between Complex IV and other respiratory complexes

    • Analyze supercomplex stability in the presence of MT-CO2 variants

    • Correlate supercomplex formation with respiratory efficiency

  • Lipid-Protein Interaction Analysis:

    • Investigate the role of specific phospholipids in mediating MT-CO2 interactions

    • Use lipidomic approaches to identify lipids associated with MT-CO2

    • Assess the impact of membrane composition on MT-CO2 function and interactions

These methodologies provide complementary insights into how MT-CO2 contributes to the structure and function of respiratory chain complexes. Understanding these interactions is particularly important for interpreting the pathogenic mechanisms of MT-CO2 variants associated with mitochondrial disorders .

What are the future research directions for studies involving Microtus pennsylvanicus MT-CO2?

Future research involving Microtus pennsylvanicus MT-CO2 holds promise in several interdisciplinary directions:

  • Evolutionary Genomics:

    • Expanded phylogenomic studies comparing MT-CO2 evolution across Cricetidae families

    • Investigation of selection pressures in different ecological niches

    • Analysis of co-evolution between mitochondrial and nuclear-encoded respiratory chain components

  • Structural Biology:

    • High-resolution structures of species-specific MT-CO2 variants

    • Comparative structural analysis between Microtus and other mammalian MT-CO2

    • Structure-based drug design targeting cytochrome c oxidase for mitochondrial therapeutics

  • Biomedical Applications:

    • Development of MT-CO2-based biomarkers for mitochondrial disorders

    • Creation of rodent models expressing Microtus MT-CO2 variants

    • Therapeutic approaches targeting MT-CO2 dysfunction in disease

  • Ecological Adaptations:

    • Investigation of MT-CO2 variants in relation to metabolic adaptations in different Microtus populations

    • Analysis of cold adaptation mechanisms in northern Microtus species

    • Assessment of mitochondrial function in response to environmental stressors

These future directions highlight the multidisciplinary potential of research involving Microtus pennsylvanicus MT-CO2, from evolutionary biology to biomedical applications, contributing to our understanding of mitochondrial function and its role in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.