Recombinant Microtus pennsylvanicus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to MT-ND3

NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) functions as an essential component of mitochondrial Complex I (NADH:ubiquinone oxidoreductase), the first and largest enzyme complex in the mitochondrial respiratory chain. Unlike many other proteins involved in cellular respiration, MT-ND3 is encoded by the mitochondrial genome rather than the nuclear genome . Complex I plays a fundamental role in cellular energy production through oxidative phosphorylation, catalyzing the transfer of electrons from NADH to ubiquinone, thereby contributing to the generation of the proton gradient necessary for ATP synthesis.

In rodents such as Microtus pennsylvanicus, MT-ND3 likely serves similar critical functions as observed in other mammalian species, although species-specific variations in protein sequence and structure may influence its precise functional properties and interactions. Understanding these species-specific characteristics proves essential for both evolutionary studies and for exploring potential applications of recombinant MT-ND3 proteins in research and biomedicine.

Predicted Properties of Recombinant Microtus pennsylvanicus MT-ND3

Based on established patterns in related recombinant proteins, a recombinant form of Microtus pennsylvanicus MT-ND3 would likely possess several characteristic properties. While direct experimental data on this specific recombinant protein remains limited, information from similar proteins such as Recombinant Bos indicus MT-ND3 provides a framework for predicting its properties .

A properly engineered recombinant Microtus pennsylvanicus MT-ND3 would typically be produced using bacterial expression systems, most commonly E. coli, and would incorporate purification tags such as a poly-histidine sequence to facilitate isolation through affinity chromatography . The full-length protein would encompass approximately 115 amino acids, corresponding to the complete coding sequence of the native MT-ND3 gene.

Table 1: Predicted Properties of Recombinant Microtus pennsylvanicus MT-ND3 Based on Homologous Proteins

PropertyCharacteristicsNotes
Protein LengthApproximately 115 amino acidsBased on conserved length across mammalian species
Molecular WeightApproximately 13-14 kDaExcluding contribution from purification tags
Expression SystemE. coliMost common system for recombinant mitochondrial proteins
Purification TagN-terminal or C-terminal His-tag6-10 histidine residues for affinity purification
Physical FormLyophilized powderFor improved stability during storage
Purity>90% by SDS-PAGEAfter optimized purification protocol
Buffer CompatibilityTris/PBS-based buffers, pH 7.4-8.0May include stabilizing agents such as trehalose
Storage Requirements-20°C to -80°CAliquoting recommended to avoid freeze-thaw cycles
ReconstitutionSterile deionized water, 0.1-1.0 mg/mLMay require addition of 5-50% glycerol for prolonged storage

The amino acid sequence of Microtus pennsylvanicus MT-ND3 would exhibit species-specific characteristics while maintaining highly conserved functional domains typical of MT-ND3 proteins across mammalian species. The protein would likely demonstrate considerable hydrophobicity, reflecting its natural environment as an integral membrane protein within the inner mitochondrial membrane. For research applications, the recombinant protein would typically be supplied in lyophilized form to ensure stability during shipping and storage, with specific reconstitution protocols designed to maintain structural integrity and functional activity .

Production Methods and Purification Strategies

The production of recombinant Microtus pennsylvanicus MT-ND3 would necessitate a multistep process utilizing established molecular biology and protein purification techniques. Based on standard protocols for similar mitochondrial membrane proteins, the production workflow would likely involve several critical stages .

The initial phase would require either direct isolation of the MT-ND3 gene from Microtus pennsylvanicus mitochondrial DNA or, more commonly, synthetic gene synthesis based on the species' mitochondrial genome sequence. The coding sequence would then be optimized for expression in the selected host system, typically incorporating codon optimization and the addition of appropriate purification tags and cleavage sites.

Following gene acquisition, the construct would be inserted into a suitable expression vector containing necessary regulatory elements such as inducible promoters (commonly T7 or tac promoters), ribosome binding sites, and transcription terminators. The recombinant plasmid would then be transformed into an expression host, with E. coli strains such as BL21(DE3), Rosetta, or C41/C43 being particularly suitable for membrane protein expression .

Protein expression would be induced under optimized conditions, which for mitochondrial membrane proteins often involves lower induction temperatures (16-25°C) and extended expression periods to promote proper folding. After sufficient expression, cells would be harvested and lysed using methods compatible with membrane protein isolation, potentially incorporating detergents such as n-dodecyl β-D-maltoside (DDM) or Triton X-100 to solubilize membrane fractions.

The purification strategy would employ multiple chromatographic steps, beginning with immobilized metal affinity chromatography (IMAC) using the incorporated His-tag . Further purification might involve ion exchange chromatography, size exclusion chromatography, or additional affinity steps depending on the intended application and required purity level. Quality control would include SDS-PAGE analysis to confirm size and purity, Western blotting for identity confirmation, and potentially mass spectrometry for sequence verification.

The final purified protein would be formulated in an appropriate buffer system, potentially including stabilizers such as trehalose (6%) or glycerol, followed by lyophilization or flash-freezing for long-term storage . Specific storage recommendations would include maintaining the protein at -20°C to -80°C, with careful attention to avoiding repeated freeze-thaw cycles that could compromise structural integrity and functional activity.

Research Applications and Significance

Recombinant Microtus pennsylvanicus MT-ND3 offers numerous potential applications in biological and biomedical research, spanning multiple disciplinary boundaries. Its availability as a purified protein would facilitate various experimental approaches that were previously challenging or impossible with native protein preparations.

In evolutionary biology, recombinant MT-ND3 from Microtus pennsylvanicus would provide valuable material for comparative studies across rodent lineages. By analyzing sequence variations and structural differences between species, researchers could gain insights into the evolutionary history of mitochondrial proteins and identify adaptive changes associated with different ecological niches or metabolic requirements . Such studies could enhance our understanding of how mitochondrial function has evolved in response to environmental pressures and contribute to speciation events.

For biochemical and biophysical investigations, purified recombinant MT-ND3 would enable detailed structural studies using techniques such as X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy. These approaches could reveal the precise three-dimensional structure of the protein, shedding light on its functional mechanisms and interactions with other components of the respiratory chain. Additionally, the availability of recombinant protein would facilitate in vitro reconstitution experiments to study Complex I assembly and function under controlled conditions.

Table 2: Potential Research Applications of Recombinant Microtus pennsylvanicus MT-ND3

Research AreaSpecific ApplicationsPotential Insights
Evolutionary BiologyComparative sequence and structural analysisPhylogenetic relationships, adaptive evolution
Structural BiologyX-ray crystallography, cryo-EM, NMR spectroscopyThree-dimensional structure, functional domains
BiochemistryEnzyme kinetics, electron transport studiesCatalytic mechanisms, energy transduction
ImmunologyAntibody production, immunoassay developmentDiagnostic tools, protein detection methods
Disease ModelingEffects of mutations on protein functionMolecular basis of mitochondrial disorders
Pharmaceutical ResearchDrug screening, inhibitor binding studiesNovel therapeutic targets, metabolic modulators
BioenergeticsCellular respiration, ATP production analysisSpecies-specific metabolic adaptations
BioengineeringProtein engineering, directed evolutionEnhanced or altered protein functionalities

In biomedical research, recombinant MT-ND3 could serve as a valuable tool for investigating the molecular basis of mitochondrial disorders. By introducing specific mutations or polymorphisms into the recombinant protein, researchers could study their effects on protein structure, stability, and function, potentially providing insights into the pathogenesis of diseases associated with mitochondrial dysfunction . Additionally, the protein could be used to develop and validate diagnostic tools for detecting mutations or abnormalities in MT-ND3 expression.

For pharmaceutical applications, recombinant MT-ND3 could facilitate drug discovery efforts targeting mitochondrial function. High-throughput screening assays using the purified protein could identify compounds that modulate Complex I activity, potentially leading to the development of new therapeutic agents for conditions associated with mitochondrial dysfunction. Furthermore, structural studies of drug-protein interactions could guide rational drug design approaches aimed at enhancing mitochondrial efficiency or reducing oxidative stress.

Comparative Analysis with Related Species

A comprehensive understanding of Microtus pennsylvanicus MT-ND3 benefits significantly from comparative analysis with homologous proteins from related species. Such comparisons reveal patterns of conservation and divergence that reflect both functional constraints and evolutionary adaptations specific to different lineages.

Within the Arvicolinae subfamily, which includes Microtus pennsylvanicus and other vole species, MT-ND3 exhibits notable patterns of sequence conservation, particularly in functionally critical regions. Studies of mitochondrial genome dynamics in this group have revealed interesting patterns regarding the formation of nuclear mitochondrial DNA segments (NUMTs), with MT-ND3 being among the mitochondrial genes that less frequently undergo insertion into the nuclear genome . This pattern appears consistent across multiple species within the subfamily, including Ellobius talpinus, Microtus agrestis, and Arvicola amphibius, suggesting evolutionary constraints that maintain the integrity of this gene.

When comparing MT-ND3 across different rodent families, certain regions of the protein show high conservation, reflecting their essential roles in Complex I function. These conserved domains typically include residues involved in ubiquinone binding, proton pumping, and interactions with other Complex I subunits . Conversely, other regions exhibit greater variability, potentially reflecting species-specific adaptations to different metabolic requirements or environmental conditions.

The relative conservation of MT-ND3 across species provides valuable context for interpreting any unique features of the Microtus pennsylvanicus protein. Regions that diverge from the consensus sequence may represent adaptations specific to this species' ecological niche or evolutionary history. Similarly, polymorphisms within the species could have functional implications, potentially affecting mitochondrial efficiency, reactive oxygen species production, or responses to environmental stressors.

Beyond rodents, broader comparative analyses with MT-ND3 from diverse mammalian lineages can provide insights into the long-term evolution of this protein and its role in mitochondrial function. Such comparisons may reveal convergent adaptations in species with similar metabolic demands or environmental challenges, despite their distant evolutionary relationships. Additionally, identification of universally conserved residues across mammals underscores their critical importance for MT-ND3 function, making them potential targets for further functional studies or therapeutic interventions in mitochondrial disorders.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please contact your local distributor.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Microtus pennsylvanicus (Meadow vole)
Target Names
Target Protein Sequence
MNMMLILLMNIALAAILISLAFWLPHLNVYTEKANPYECGFDPMSSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAMQFPNMNMLMTMAFILITILALGLAYEWTQKGLEWTE
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. It plays a crucial role in the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.