Recombinant Microtus pennsylvanicus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant MT-ND4L is expressed in E. coli and purified via nickel affinity chromatography due to its His tag. Key production parameters include:

ParameterDetails
Host SystemE. coli
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50%) recommended
StabilityLyophilized form stable for 12 months at -20°C/-80°C

Repeated freeze-thaw cycles are discouraged to preserve activity .

Functional Role in Mitochondrial Energy Metabolism

MT-ND4L participates in the first electron transfer step of oxidative phosphorylation:

  1. Electron Transfer: Facilitates the transfer of electrons from NADH to ubiquinone (CoQ10) .

  2. Proton Pumping: Contributes to the proton gradient across the mitochondrial membrane, driving ATP synthesis .

  3. Complex I Assembly: Forms part of the minimal catalytic core required for Complex I activity .

Metabolomic and Genetic Associations

A mitochondrial genome-wide association study identified mt10689 G>A (ND4L) as a variant linked to 16 metabolite ratios, including:

Metabolite RatioAssociationP-value
PC diacyl C36:6 / PC aa C38:5Sphingolipid/glycerophospholipid ratio1.01 × 10⁻⁷
PC ae C34:3 / PC aa C36:6Glycerophospholipid/glycerophospholipid ratio1.44 × 10⁻⁷
SM:C26:0 / PC aa C38:5Sphingolipid/glycerophospholipid ratio1.93 × 10⁻⁷

This variant involves the fourth E-channel of Complex I, critical for proton translocation .

Clinical Relevance and Disease Links

While the Microtus pennsylvanicus recombinant protein itself is not directly implicated in human disease, homologous human MT-ND4L mutations are associated with:

  • Leber Hereditary Optic Neuropathy (LHON): A G→A mutation at position 10,663 disrupts Complex I function, leading to optic neuropathy .

  • Metabolic Disorders: Variants in ND4L and other Complex I subunits correlate with obesity, diabetes, and hypertension .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Microtus pennsylvanicus (Meadow vole)
Target Names
Target Protein Sequence
MTPAVFNITLAFSFSLLGTLMFRSHLMSTLLCLEGMMLSPFILATITPLNTHSMIMFPIP IVILVFAACEAAVGLALLAKISNTYGSDFVHNLNLLQC
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its biological function?

MT-ND4L (mitochondrial NADH-ubiquinone oxidoreductase chain 4L) encodes the NADH dehydrogenase 4L protein, which serves as an essential component of mitochondrial Complex I in the electron transport chain. This protein participates in oxidative phosphorylation by facilitating the transfer of electrons from NADH to ubiquinone, which represents the initial step in the electron transport process. Within mitochondria, MT-ND4L is embedded in the inner mitochondrial membrane where it contributes to generating the electrochemical gradient necessary for ATP production. The protein plays a crucial role in energy metabolism by helping create an unequal electrical charge across the inner mitochondrial membrane through electron transfer, ultimately providing the energy required for ATP synthesis.

How should recombinant MT-ND4L be properly stored and handled in laboratory settings?

For optimal stability and activity preservation, recombinant MT-ND4L should be stored at -20°C for standard storage periods, while extended storage requires conservation at -80°C. Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles. Importantly, repeated freezing and thawing should be avoided as this can compromise protein integrity and functionality. The protein is typically supplied in a Tris-based buffer with 50% glycerol, which serves as a cryoprotectant and stabilizing agent. Researchers should handle the protein according to standard laboratory practices for recombinant proteins, including maintaining sterile conditions and using appropriate personal protective equipment during experimental procedures.

What experimental techniques are commonly used to study MT-ND4L function?

Several experimental approaches are employed to investigate MT-ND4L function:

  • ELISA-based detection methods: These utilize recombinant MT-ND4L as a standard for quantitative analysis and protein interaction studies.

  • Genetic editing techniques: Advanced base editing tools such as DdCBEs (DddA-derived cytosine base editors) have been developed to introduce precise mutations in MT-ND4L. For example, researchers have developed methods to change codons in MT-ND4L from GTC CAA (encoding Val-Gln) to GTT TAA (Val-STOP), generating premature stop codons to study knockout phenotypes.

  • Conformational analysis: AI-driven molecular dynamics simulations can generate conformational ensembles of MT-ND4L, revealing its structure-function relationships and dynamic behavior.

  • Binding pocket identification: Computational approaches combined with structural analysis identify orthosteric, allosteric, and cryptic binding sites on MT-ND4L's surface, providing insights into potential drug targeting mechanisms.

How do mutations in MT-ND4L contribute to mitochondrial disorders, particularly Leber hereditary optic neuropathy?

Mutations in MT-ND4L have been implicated in mitochondrial disorders, most notably Leber hereditary optic neuropathy (LHON). A specific mutation, T10663C (Val65Ala), has been identified in several families with LHON. This mutation substitutes the amino acid valine with alanine at position 65 of the NADH dehydrogenase 4L protein. While the exact pathomechanism remains incompletely understood, the mutation likely disrupts Complex I function in the electron transport chain, leading to decreased ATP production and increased reactive oxygen species generation. These biochemical alterations appear particularly detrimental to retinal ganglion cells, which have high energy demands, resulting in the characteristic vision loss associated with LHON. The mutation's tissue-specific effects may relate to the unique metabolic requirements of retinal cells and their vulnerability to mitochondrial dysfunction.

What methodological approaches can be used to study MT-ND4L conformational dynamics and its impact on complex I assembly?

Studying MT-ND4L conformational dynamics requires sophisticated methodological approaches:

  • AI-Enhanced Molecular Dynamics Simulations: This approach begins with the initial protein structure and employs advanced AI algorithms to predict alternative functional states of MT-ND4L. These simulations can identify large-scale conformational changes along "soft" collective coordinates and explore the broad conformational space of the protein through enhanced sampling techniques and trajectory clustering.

  • Diffusion-Based AI Models: Combined with active learning AutoML, these generate statistically robust ensembles of equilibrium protein conformations that capture the receptor's full dynamic behavior, establishing a foundation for structure-based analyses.

  • Cryo-EM Structure Analysis: This technique provides high-resolution structural data of Complex I with MT-ND4L in its native environment, revealing interaction interfaces with other subunits.

  • Protein-Protein Interaction Mapping: Using crosslinking mass spectrometry, researchers can identify specific residues involved in MT-ND4L's interactions with other Complex I components, clarifying its role in complex assembly.

  • Integration with Knowledge Graphs: AI-powered literature mining can formalize relevant information about MT-ND4L from diverse data sources, providing insights into protein-protein interactions and structural determinants of function.

What is the relationship between MT-ND4L expression changes and metabolic alterations in cellular models?

Research indicates MT-ND4L expression changes have significant long-term consequences on energy metabolism, potentially serving as a major predisposition factor for metabolic disorders. Mitochondrial genome-wide association studies have investigated relationships between mitochondrial variants and metabolomic profiles, though specific details regarding MT-ND4L's metabolic impact remain partially characterized.

A methodological approach to studying this relationship involves:

  • Gene Expression Modulation: Using techniques like RNA interference or CRISPR-Cas9 to alter MT-ND4L expression levels.

  • Metabolomic Profiling: Employing mass spectrometry-based metabolomics to quantify changes in cellular metabolites, particularly those involved in energy metabolism pathways.

  • Metabolite Ratio Analysis: Analyzing specific metabolite ratios, such as acylcarnitines or phosphatidylcholines, which can serve as sensitive indicators of mitochondrial function and have been used in mitochondrial genome association studies.

  • Oxygen Consumption Measurements: Quantifying cellular oxygen consumption rates as a direct measure of mitochondrial respiratory function in response to MT-ND4L expression changes.

  • ATP Production Assays: Measuring cellular ATP levels to assess the functional impact of MT-ND4L alterations on energy production capacity.

How can genome editing technologies be optimized for studying MT-ND4L function in cellular and animal models?

Recent advances in genome editing technologies have enabled precise manipulation of mitochondrial genes, including MT-ND4L. The optimization process involves several methodological considerations:

  • Base Editor Design: For MT-ND4L-specific studies, researchers have designed DdCBE (DddA-derived cytosine base editor) pairs containing TALE domains binding to either the light (L) or heavy (H) strands of mtDNA. These editors can introduce precise C-to-T conversions, generating premature stop codons. For example, in MT-ND4L, researchers specifically designed editors to change the coding sequence for Val90 and Gln91 (GTC CAA) into Val and STOP (GTT TAA).

  • Split Orientation Optimization: The orientation of split DddA toxin fragments (1333 N and 1333 C) relative to the TALE domains significantly impacts editing efficiency. For MT-ND4L specifically, linking the 1333 C fragment with H-strand binding TALEs produced optimal editing outcomes.

  • Sequential Transfection Approach: To achieve high levels of mitochondrial DNA modification, sequential rounds of transfection and recovery have proven effective. This process typically involves:

    • Transfection with the editing construct

    • Selection of transfectants via FACS at 24 hours post-transfection

    • A recovery period of 14 days

    • Heteroplasmy measurement

    • Re-transfection

This iterative approach has successfully generated effectively homoplasmic cells harboring premature stop codons in MT-ND4L and other mitochondrial genes.

  • Off-Target Effect Mitigation: Careful design and validation of base editors include scoring systems that penalize mtDNA off-targets with heteroplasmy greater than 5%, ensuring specificity to the MT-ND4L target site.

What are the optimal conditions for expressing and purifying recombinant MT-ND4L protein?

Expressing and purifying recombinant MT-ND4L requires specialized approaches due to its hydrophobic nature as a mitochondrial membrane protein. The optimal methodology includes:

  • Expression System Selection: Bacterial systems (typically E. coli) modified with rare codon supplements can be used, though eukaryotic systems like insect cells may provide better folding for this mitochondrial protein.

  • Fusion Tag Optimization: While the tag type is typically determined during the production process, commonly used tags include His6, GST, or MBP to enhance solubility and facilitate purification. For MT-ND4L, solubility-enhancing tags are particularly important given its hydrophobic membrane protein nature.

  • Detergent Selection: Critical for membrane protein extraction and stability, typically employing mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin.

  • Buffer Composition: The final storage buffer typically consists of a Tris-based formulation with 50% glycerol, optimized specifically for MT-ND4L stability.

  • Purification Strategy: Typically involves immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography (SEC) to achieve high purity levels.

  • Quality Control: SDS-PAGE, Western blotting, and mass spectrometry confirm purity, identity, and integrity of the recombinant protein.

How can researchers design experiments to investigate MT-ND4L's role in complex I assembly and function?

Designing experiments to investigate MT-ND4L's role in complex I requires multi-faceted approaches:

  • Site-Directed Mutagenesis: Introducing specific mutations that mirror disease-associated variants (such as Val65Ala) or target conserved residues to assess their impact on complex I assembly and function.

  • Protein-Protein Interaction Analysis: Employing co-immunoprecipitation, proximity labeling, or crosslinking mass spectrometry to identify MT-ND4L's interaction partners within complex I.

  • Blue Native PAGE: Analyzing complex I assembly states in models with altered MT-ND4L expression or mutations to determine its role in complex stability and assembly.

  • In vitro Complex I Activity Assays: Measuring NADH:ubiquinone oxidoreductase activity in reconstituted systems with wild-type versus mutant MT-ND4L to quantify functional impacts.

  • MitoKO Base Editing Approach: Utilizing the MitoKO library of DdCBEs to introduce premature stop codons in MT-ND4L, enabling loss-of-function studies in cellular models. This can be achieved through strategies like changing the Val90-Gln91 codons (GTC CAA) to Val-STOP (GTT TAA), as demonstrated in recent research.

  • Mitochondrial Membrane Potential Measurements: Assessing the electrochemical gradient generation in models with altered MT-ND4L to determine functional consequences.

What methodological considerations should be addressed when using recombinant MT-ND4L in structural studies?

Structural studies of recombinant MT-ND4L present unique challenges that require specific methodological considerations:

  • Detergent Selection: Critical for maintaining protein integrity in solution while mimicking the membrane environment. Common choices include DDM, LMNG, or amphipols for membrane protein stabilization.

  • Lipid Nanodisc Reconstitution: Incorporating MT-ND4L into nanodiscs provides a more native-like membrane environment for structural studies, potentially revealing physiologically relevant conformations.

  • Cryo-EM Sample Preparation: Given MT-ND4L's small size (98 amino acids), it might be challenging to visualize independently; studying it within the context of the entire complex I or designing fusion constructs can enhance visualization.

  • AI-Driven Conformational Analysis: Employing advanced AI algorithms as demonstrated by Receptor.AI can predict alternative functional states and generate robust conformational ensembles that capture the protein's dynamic behavior.

  • Structure Validation: Using complementary techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) or small-angle X-ray scattering (SAXS) to validate computational models.

  • Integration with Functional Data: Correlating structural findings with functional assays to establish structure-function relationships, particularly for regions implicated in disease-causing mutations like Val65Ala.

How might MT-ND4L be targeted for therapeutic development in mitochondrial disorders?

MT-ND4L represents a potential therapeutic target, particularly for mitochondrial disorders like Leber hereditary optic neuropathy. Methodological approaches for therapeutic development include:

  • Small Molecule Screening: Utilizing AI-identified binding pockets on MT-ND4L to screen for small molecules that could modulate complex I activity or stabilize mutant forms of the protein. This approach leverages computational predictions of orthosteric, allosteric, hidden, and cryptic binding pockets.

  • Gene Therapy Approaches: Developing mitochondrially-targeted nucleic acid delivery systems to introduce wild-type MT-ND4L in cells harboring pathogenic mutations.

  • Base Editing Technology: Adapting DdCBE technology used in research applications for therapeutic correction of point mutations in MT-ND4L, potentially reversing the Val65Ala mutation associated with LHON.

  • Peptide-Based Modulators: Designing peptides that mimic critical interaction interfaces of MT-ND4L to stabilize complex I assembly in cases of pathogenic mutations.

  • Metabolic Bypass Strategies: Developing compounds that can bypass complex I dysfunction, such as alternative electron carriers or mitochondrial-targeted antioxidants to address downstream consequences of MT-ND4L mutations.

What is the significance of MT-ND4L mutations in the pathogenesis of Leber hereditary optic neuropathy?

The T10663C (Val65Ala) mutation in MT-ND4L has been identified in several families with Leber hereditary optic neuropathy (LHON), highlighting its clinical significance. The methodological approach to understanding this pathogenesis includes:

  • Biochemical Characterization: Assessing how the Val65Ala mutation affects complex I assembly, stability, and electron transfer efficiency through activity assays and structural studies.

  • Cellular Models: Generating cybrid cell lines harboring the mutation to study tissue-specific effects, particularly in neuronal cells that mimic retinal ganglion cells affected in LHON.

  • Oxidative Stress Measurements: Quantifying reactive oxygen species production in cells with mutant MT-ND4L to determine if oxidative stress contributes to the pathology.

  • ATP Production Assays: Measuring cellular energy production to assess if energy deficiency is a primary consequence of the mutation.

  • Tissue-Specific Expression Analysis: Investigating why retinal ganglion cells are particularly susceptible to this mutation through comparative expression and metabolic profiling of different tissues.

How does MT-ND4L gene expression influence metabolic pathways and predisposition to metabolic disorders?

Changes in MT-ND4L gene expression have long-term consequences on energy metabolism and may serve as a predisposition factor for metabolic disorders. The methodological approach to investigate this relationship includes:

  • Metabolomic Profiling: Using mass spectrometry to analyze changes in the metabolome associated with altered MT-ND4L expression, focusing on key metabolic pathways like fatty acid oxidation, TCA cycle, and amino acid metabolism.

  • Mitochondrial Genome-Wide Association Studies: Analyzing relationships between mitochondrial variants, including those in MT-ND4L, and metabolite ratios such as phosphatidylcholine species (PC ae C42:5/PC ae C44:5) which have shown significant associations with mitochondrial variants.

  • Flux Analysis: Employing isotope-labeled substrates to track metabolic flux through various pathways in models with altered MT-ND4L expression.

  • Integration with Clinical Data: Correlating MT-ND4L variants with clinical metabolic parameters in patient cohorts to establish potential links to disorders like diabetes, obesity, or metabolic syndrome.

  • Longitudinal Studies: Tracking long-term metabolic changes in models with altered MT-ND4L expression to understand the progressive nature of metabolic adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.