Recombinant Mink astrovirus 1 Non-structural polyprotein 1AB (ORF1)

Shipped with Ice Packs
In Stock

Description

Functional Roles

ORF1AB is processed into two non-structural proteins:

  • Protease (nsP1a): Mediates polyprotein cleavage, enabling viral maturation .

  • RdRp (nsP1b): Synthesizes viral RNA via a -1 ribosomal frameshift mechanism .

Studies on human astroviruses reveal that nsP1a contains di-arginine motifs necessary for endoplasmic reticulum (ER) retention and replication complex (RC) formation . Deletions in nsP1a (e.g., 57 aa in AstV-MLB1) may alter host-cell apoptosis and viral replication efficiency .

Comparative Genomics

  • MAstV-1 ORF1 shares 77.5% RdRp identity with pinniped astroviruses, suggesting evolutionary conservation among Mamastroviruses .

  • ORF1b is the least divergent region across astroviruses, while ORF2 (capsid) shows high variability due to host immune pressure .

Replication Mechanisms

  • The slippery sequence AAAAAAAC in ORF1a initiates frameshifting for RdRp expression .

  • Insertion mutagenesis in porcine astrovirus ORF1a demonstrated tolerance for exogenous tags (e.g., His, Flag) in hypervariable regions (HVR), enabling tagged-protein applications .

Pathogenesis

  • MAstV-1 infection in minks is linked to gastroenteritis, with ORF1AB driving viral replication in intestinal epithelial cells .

Applications in Research

  • Antiviral Development: ORF1AB’s protease and RdRp are targets for inhibitor screening .

  • Diagnostics: Recombinant ORF1AB serves as an antigen for antibody generation .

  • Evolutionary Studies: Phylogenetic analysis of ORF1AB helps trace astrovirus host adaptation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ORF1; Non-structural polyprotein 1AB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
868-1381
Protein Length
Full Length of Mature Protein
Species
Mink astrovirus 1 (MAstV-1)
Target Names
ORF1
Target Protein Sequence
EGPERGPINPDEMRLDHWEKMMAPPDAGRRLVPDDYPVIGKLPINRPISDWDEPVDDLLN LLPPAPDSSAYGPAVWGPEAYVKSFEKFTYAKPRDSIKRDFPREWKFACQVLRREFDFLE GSVIMDITATSKNADSTCAYPKCNYWKTEAEYLSERGYQDYVSEYKRIHGGARPKVLWLL FLKKEILKVKKINDSDIRQIVCADPIFARIGNAFEEHQNTLMKHRTATRMPQCGWTPFFN GFKRRIERLLSRKNSVFIEFDWTRYDGTIPREIFAKIKSFRFSCLAEEFQTDANRAMYQW YCDSLLDRYVLMPSGEVTRQTKGNPSGQISTTMDNNLCNVFFQAFEYAYIHPEKSIEELR ESWDRCDSLIYGDDRLTTFDHVPPDYVDRVVHMYKDVFGMWVKPEKVIVSDTPVGLSFCG FTVGPDLMPVPTDCDKLVASLVTPTKKLQDIVALYSKVLCYRILGHNLSDEHEFKRYVRV ALEVLARHIRNLGGEEPVHVTERLLDKLWRGGPK
Uniprot No.

Target Background

Function
This protein contains the viral protease involved in the cleavage of the polyprotein into functional products. It also harbors the activities necessary for the replication of genomic RNA and the transcription of subgenomic mRNA. This protein is covalently attached to the 5' extremity of the genomic and subgenomic RNAs.
Database Links

KEGG: vg:29200741

Protein Families
Astroviridae polyprotein 1AB family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Mink astrovirus 1 Non-structural polyprotein 1AB (ORF1)?

Mink astrovirus 1 Non-structural polyprotein 1AB (ORF1) is encoded by the viral genomic RNA. The protein contains several functional domains that are processed post-translationally. Based on research findings, astroviruses contain three open reading frames (ORFs) on their genomic RNA: ORF1a, ORF1b, and ORF2 . ORF1a encodes nonstructural proteins, including a 920-amino-acid nonstructural protein (nsP1a) which displays a 3C-like serine protease motif that is critical for viral replication . The protein undergoes proteolytic processing to produce several functional products, including p20 and p27 fragments, with cleavage sites mapped near amino acids 170, 410, and 655 .

How does the processing of Mink astrovirus 1 Non-structural polyprotein occur?

The processing of astrovirus nonstructural polyprotein involves autocatalytic cleavage mediated by the viral protease. Experimental evidence from human astrovirus serotype 1 (HAstV-1) indicates that the nonstructural polyprotein undergoes multiple processing events to generate functional protein products. When expressed in BHK cells, the full-length nsP1a undergoes proteolytic processing to produce distinct fragments that can be detected by immunoprecipitation with specific antibodies .

This processing pattern has been validated by comparing nsP1a processing products in Caco-2 cells infected with wild-type HAstV-1 and in BHK cells expressing ORF1a through vaccinia virus-based expression systems. The detection of identical specific bands (28 kDa) in both systems confirms the physiological relevance of the processing events observed in experimental models .

What is the significance of studying astrovirus nonstructural proteins?

Studying astrovirus nonstructural proteins is critical because:

  • Astroviruses are a significant cause of gastroenteritis in infants worldwide and have been increasingly associated with extra-intestinal infections such as fatal meningitis and encephalitis, particularly in immunocompromised individuals .

  • Understanding the molecular mechanisms of viral replication and processing is essential for developing targeted antiviral strategies.

  • The nonstructural proteins play crucial roles in viral RNA replication, protein processing, and potentially in virus-host interactions that determine pathogenicity.

  • Despite their clinical importance, astroviruses remain among the least studied groups of human positive-sense RNA viruses, creating significant knowledge gaps in viral biology .

What methods are recommended for expression and purification of recombinant Mink astrovirus 1 Non-structural polyprotein?

Based on established protocols, researchers can effectively express and purify recombinant Mink astrovirus 1 Non-structural polyprotein using the following methodology:

  • Expression system selection: E. coli is commonly used for expression of recombinant Mink astrovirus 1 Non-structural polyprotein fragments, as evidenced by commercially available recombinant proteins . For studying processing, mammalian expression systems such as BHK cells with vaccinia virus-driven infection-transfection systems have proven effective .

  • Construct design: For optimal expression, the protein can be expressed with an N-terminal His-tag to facilitate purification . Various protein fragments may be expressed to study specific domains, such as the mature protein region (amino acids 663-874) .

  • Purification strategy: Affinity chromatography using the His-tag is effective for initial purification, followed by additional chromatography steps if higher purity is required.

  • Quality control: Purity assessment by SDS-PAGE (>90% purity is generally achievable) and functional validation through enzymatic assays for the protease activity.

  • Storage: Store purified protein at -20°C/-80°C in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . For extended storage, addition of 5-50% glycerol is recommended to prevent freeze-thaw damage .

What are the recommended conditions for reconstitution and storage of recombinant Mink astrovirus 1 proteins?

For optimal results when working with recombinant Mink astrovirus 1 Non-structural polyprotein, the following reconstitution and storage protocols are recommended:

  • Reconstitution procedure:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (with 50% being commonly used) to prevent freeze-thaw damage

  • Storage recommendations:

    • Store reconstituted protein at -20°C/-80°C for long-term storage

    • Prepare working aliquots to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Stability considerations:

    • Repeated freezing and thawing significantly decreases protein stability and should be avoided

    • For extended storage, the protein should be kept at -20°C or preferably -80°C

How can researchers validate the functional activity of recombinant astrovirus nonstructural proteins?

Validating the functional activity of recombinant astrovirus nonstructural proteins requires multiple complementary approaches:

  • Protease activity assay: Since the nonstructural polyprotein contains a 3C-like serine protease domain, researchers can assess protease activity using synthetic peptide substrates corresponding to known cleavage sites. Activity can be measured by monitoring substrate cleavage through fluorescence-based assays or HPLC.

  • Auto-processing verification: Examining the ability of the recombinant protein to undergo self-cleavage in vitro can be performed through time-course incubation followed by SDS-PAGE analysis to detect processing products .

  • Cell-based processing assays: Expression of the protein in cell culture systems (such as BHK cells) followed by immunoprecipitation to detect processing products can validate physiological activity. This approach has been demonstrated for human astrovirus nsP1a and can be adapted for Mink astrovirus proteins .

  • Trans-cleavage activity: Testing the ability of the protease domain to cleave other viral or substrate proteins in trans provides additional evidence of functional activity.

  • Comparison with viral infection: Comparing the processing patterns observed with recombinant proteins to those seen in actual viral infection validates the physiological relevance of the recombinant protein's activity, as demonstrated with human astrovirus in Caco-2 cells .

How does the newly discovered XP protein encoded by astroviruses interact with nonstructural proteins?

The recently discovered XP protein, encoded by an alternative open reading frame in astroviruses, represents a significant advancement in understanding astrovirus biology. Research indicates potential interactions with nonstructural proteins as part of the viral replication complex:

  • Genomic location: Comparative genomic analysis has identified a conserved alternative-frame ORF that encodes the XP protein in genogroup I, III, and IV astroviruses . This hidden gene was detected through ribosome profiling and exhibits evidence of purifying selection, suggesting functional importance .

  • Functional role: Experimental evidence indicates that XP has membrane-associated roles in virus assembly and/or release through viroporin-like activity. XP appears to interact with plasma and trans Golgi network membranes .

  • Interaction with viral life cycle: XP-knockout astroviruses are attenuated and undergo pseudo-reversion upon passaging, indicating selective pressure to maintain XP function. Importantly, XP-knockout replicons show only minor replication defects, suggesting that XP functions primarily at late stages of infection rather than during RNA replication .

  • Potential interactions with nonstructural proteins: While direct interactions between XP and nonstructural proteins like polyprotein 1AB remain to be fully characterized, the role of XP in virus assembly and release suggests potential coordination with the functions of nonstructural proteins in the viral replication cycle.

  • Research implications: The discovery of XP opens new directions for research into astrovirus life cycle and pathogenesis, potentially revealing novel target sites for antiviral interventions .

What methodological approaches are recommended for studying astrovirus protein processing in vitro?

Advanced methodological approaches for studying astrovirus protein processing in vitro include:

  • Cell-free expression systems:

    • Wheat germ or rabbit reticulocyte lysate systems can be used to express full-length nsP1a and nsP1a/1b for analyzing autocatalytic processing events

    • These systems allow controlled conditions for studying protease activity and processing kinetics

  • Vaccinia virus-driven expression systems:

    • As demonstrated in HAstV-1 studies, vaccinia virus-driven infection-transfection systems in BHK cells allow expression of full-length or truncated forms of astrovirus nonstructural proteins

    • This approach enables the mapping of cleavage sites through expression of deleted and mutated forms of the polyprotein

  • Metabolic labeling and immunoprecipitation:

    • Proteins can be metabolically labeled with radioactive amino acids ([35S]methionine) followed by immunoprecipitation with specific antibodies

    • This approach allows detection of processing products and kinetic analysis of processing events

  • Site-directed mutagenesis:

    • Targeted mutation of putative cleavage sites or catalytic residues in the protease domain

    • Analysis of processing patterns of mutated constructs helps map cleavage sites and understand the mechanism of protease activity

  • Comparative analysis with infected cells:

    • Validation of in vitro findings by comparing with processing patterns in naturally infected cells (e.g., Caco-2 cells infected with wild-type astrovirus)

    • This approach confirms the physiological relevance of processing events observed in vitro

What are the key considerations for designing experiments to study interactions between astrovirus nonstructural proteins and host cell factors?

When designing experiments to investigate interactions between astrovirus nonstructural proteins and host cellular factors, researchers should consider the following key aspects:

  • Selection of appropriate cellular models:

    • Intestinal epithelial cell lines (e.g., Caco-2) for studying interactions relevant to gastroenteritis

    • Neuronal cell lines for research focused on neurotropic astrovirus strains associated with encephalitis

    • Primary cells where possible to confirm findings in more physiologically relevant systems

  • Protein expression strategies:

    • Epitope-tagged viral proteins to facilitate detection and purification

    • Inducible expression systems to control expression levels and timing

    • Both full-length polyproteins and individual processed products should be studied, as they may have distinct interaction partners

  • Interaction detection methods:

    • Co-immunoprecipitation followed by mass spectrometry for unbiased identification of interaction partners

    • Proximity labeling approaches (BioID, APEX) to capture transient or weak interactions

    • Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) for visualizing interactions in living cells

  • Functional validation approaches:

    • siRNA or CRISPR-based knockdown/knockout of identified host factors

    • Mutagenesis of viral protein interaction domains

    • Competitive inhibition using peptides or small molecules targeting interaction interfaces

  • Subcellular localization studies:

    • Confocal microscopy to track localization of viral proteins during infection

    • Subcellular fractionation to biochemically confirm localization patterns

    • Time-course analysis to capture dynamic changes in localization and interactions

What structural domains are present in Mink astrovirus 1 Non-structural polyprotein 1AB and what are their functions?

The Mink astrovirus 1 Non-structural polyprotein 1AB contains several functional domains important for viral replication. Based on structural and functional analyses of astrovirus nonstructural proteins, the following domains are likely present:

  • N-terminal domains (p19 and transmembrane protein 1A region):

    • Based on human astrovirus studies, the N-terminal region contains a p19 protein followed by a transmembrane domain

    • These regions may be involved in anchoring the replication complex to cellular membranes

    • Cleavage sites in human astrovirus have been mapped near amino acid 170

  • Serine protease domain (p27 region):

    • A 3C-like serine protease motif essential for polyprotein processing

    • This domain is responsible for both cis (autocatalytic) and trans cleavage activities

    • The catalytic triad likely consists of histidine, aspartic acid, and serine residues

  • p20 protein region:

    • Located downstream of the protease domain

    • Specific function not fully characterized but likely involved in viral replication complex formation

  • C-terminal region:

    • Contains sequences involved in RNA binding and potentially in interactions with the viral RNA-dependent RNA polymerase

    • May include conserved motifs that participate in genome replication

In human astrovirus, the processing of nsP1a generates fragments of approximately 20 kDa and 27 kDa, with cleavage sites near amino acids 170, 410, and 655 . Similar processing patterns likely occur in Mink astrovirus 1 Non-structural polyprotein, although species-specific differences may exist.

How do mutations in the protease domain of astrovirus nonstructural polyprotein affect viral replication?

Mutations in the protease domain of astrovirus nonstructural polyprotein can significantly impact viral replication through multiple mechanisms:

  • Impaired polyprotein processing:

    • Mutations in the catalytic triad (His, Asp, Ser) abolish protease activity, preventing the generation of mature viral proteins required for replication complex formation

    • Alterations in substrate recognition sites may cause abnormal processing patterns, leading to dysfunctional viral proteins

  • Effects on viral RNA replication:

    • Proper processing of nonstructural proteins is essential for the assembly of functional replication complexes

    • Defective processing due to protease mutations results in reduced RNA synthesis and virus production

  • Altered virus-host interactions:

    • The protease domain may cleave host proteins to modulate cellular processes or evade immune responses

    • Mutations can disrupt these functions, potentially affecting viral pathogenicity and host range

  • Compensation mechanisms:

    • Experimental evidence from other RNA viruses suggests that secondary mutations may arise to compensate for defects in protease activity

    • These compensatory mutations can provide insights into functional relationships between viral proteins

Research approaches to study the effects of protease mutations include site-directed mutagenesis of catalytic residues, expression of mutant proteins in cell culture, analysis of polyprotein processing patterns, and assessment of viral RNA replication using replicon systems.

What is the role of RNA secondary structures in regulating the expression of astrovirus nonstructural proteins?

RNA secondary structures play crucial roles in regulating the expression of astrovirus nonstructural proteins through several mechanisms:

  • Ribosomal frameshifting:

    • Astroviruses utilize programmed ribosomal frameshifting to express the RNA-dependent RNA polymerase (RdRp) encoded by ORF1b

    • This frameshifting occurs at a conserved A_AAA_AAC sequence within the ORF1a/ORF1b overlap region and depends on a 3′-adjacent stimulatory RNA stem-loop structure

    • The efficiency of frameshifting, controlled by this RNA structure, determines the ratio of nsP1a to nsP1a/1b polyprotein production

  • Translation initiation regulation:

    • RNA structures in the 5' untranslated region likely influence ribosome recruitment and translation efficiency of the viral genome

  • Subgenomic RNA synthesis:

    • Conserved RNA elements at the junction of ORF1b and ORF2 are involved in subgenomic RNA production

    • These elements have been detected through comparative genomic analysis showing regions with significantly enhanced synonymous site conservation

  • Genome replication signals:

    • Conserved RNA structures toward the 3' end of the genome serve as recognition signals for the viral replication machinery

    • These structures have been identified through comparative genomic analysis of multiple astrovirus strains

  • Alternative ORF expression:

    • RNA structures may play a role in the expression of the recently discovered XP protein, which is encoded by an alternative reading frame

    • Comparative genomic analysis revealed conservation patterns consistent with functional RNA elements in the regions where XP is encoded

Understanding these RNA structures provides insights into viral gene expression regulation and offers potential targets for antiviral strategies that disrupt these critical regulatory elements.

How do nonstructural proteins from different astrovirus genogroups compare in terms of structure and function?

Comparative analysis of nonstructural proteins from different astrovirus genogroups reveals both conserved features and significant variations:

This comparative analysis highlights the evolutionary dynamics of astrovirus nonstructural proteins and provides insights into essential versus adaptable features of the viral replication machinery.

What evolutionary pressures drive conservation of functional domains in astrovirus nonstructural proteins?

Evolutionary analysis of astrovirus nonstructural proteins reveals several selective pressures driving conservation of functional domains:

Understanding these evolutionary constraints provides insights into essential viral functions and potential targets for broad-spectrum antiviral strategies that target highly conserved regions of the viral proteins.

How can recombinant Mink astrovirus 1 proteins be used as models for understanding other astrovirus species?

Recombinant Mink astrovirus 1 nonstructural proteins can serve as valuable models for understanding broader astrovirus biology through several approaches:

  • Comparative functional studies:

    • Mink astrovirus 1 proteins can be studied alongside recombinant proteins from human and other animal astroviruses to identify conserved functional properties

    • This comparative approach helps distinguish universal astrovirus features from species-specific adaptations

  • Cross-species protease activity analysis:

    • The 3C-like protease from Mink astrovirus can be tested for activity against substrate sequences from other astrovirus species

    • This reveals the specificity determinants of protease recognition and processing efficiency

  • Structure-function relationship studies:

    • Structural analysis of recombinant Mink astrovirus proteins can inform predictions about other astrovirus proteins where structural data is lacking

    • Homology modeling based on solved structures allows prediction of functional sites in related viruses

  • Model for screening antiviral compounds:

    • Recombinant Mink astrovirus proteins, particularly the protease domain, can be used in high-throughput screening assays for inhibitor discovery

    • Compounds effective against Mink astrovirus proteins can be evaluated for broad-spectrum activity against other astrovirus species

  • Understanding evolutionary conservation:

    • Functional characterization of Mink astrovirus proteins helps identify critical conserved domains that may be targets for broad-spectrum antivirals

    • Regions showing high functional conservation despite sequence divergence highlight essential viral mechanisms

  • XP protein studies:

    • Mink astrovirus 1 can serve as a model for studying the newly discovered XP protein's function

    • Findings can be extrapolated to understand the role of XP in other astrovirus genogroups that encode this protein

By serving as a well-characterized model system, studies using recombinant Mink astrovirus 1 proteins can accelerate understanding of astrovirus biology across multiple species, potentially leading to broadly applicable antiviral strategies.

What are common challenges in expressing and purifying recombinant astrovirus proteins and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant astrovirus proteins. Here are the most common issues and recommended solutions:

  • Poor expression levels:

    • Challenge: Viral proteins often contain sequences that are poorly expressed in heterologous systems.

    • Solutions:

      • Optimize codon usage for the expression host

      • Use strong inducible promoters

      • Express protein fragments rather than full-length polyproteins

      • Test multiple expression systems (bacterial, insect, mammalian)

      • Consider fusion tags that enhance solubility (MBP, SUMO, etc.)

  • Protein insolubility:

    • Challenge: Viral proteins, particularly those with transmembrane domains, often form inclusion bodies.

    • Solutions:

      • Lower induction temperature (16-20°C)

      • Reduce inducer concentration

      • Express soluble domains separately

      • Use solubility-enhancing buffer components (glycerol, mild detergents)

      • For refolding, use gradual dialysis with decreasing denaturant concentrations

  • Autocatalytic processing:

    • Challenge: The protease domain in nonstructural polyproteins can cause premature processing during expression.

    • Solutions:

      • Introduce mutations in the catalytic site for studying intact polyproteins

      • Use protease inhibitors during purification

      • Express individual domains separately when autocatalytic activity interferes with research goals

  • Protein instability:

    • Challenge: Purified viral proteins may show limited stability in storage.

    • Solutions:

      • Add stabilizing agents such as glycerol (5-50%)

      • Store in small aliquots to minimize freeze-thaw cycles

      • Use preservative-free protease inhibitor cocktails

      • Optimize buffer composition (pH, salt concentration, additives)

  • Low purity:

    • Challenge: Contaminating host proteins can co-purify with the target protein.

    • Solutions:

      • Implement multi-step purification strategies

      • Use tandem affinity tags

      • Consider ion exchange chromatography as a polishing step

      • Validate purity by SDS-PAGE and mass spectrometry

How can researchers optimize processing assays to study astrovirus nonstructural protein cleavage events?

Optimizing processing assays for studying astrovirus nonstructural protein cleavage requires careful attention to several experimental parameters:

  • Substrate design considerations:

    • Peptide substrates: Design synthetic peptides containing known or predicted cleavage sites with flanking sequences (10-15 amino acids on each side)

    • Fluorogenic substrates: Incorporate FRET pairs (such as EDANS/DABCYL) flanking the cleavage site for real-time monitoring of protease activity

    • Protein substrates: Express larger protein fragments containing natural cleavage sites for more physiologically relevant assays

  • Assay condition optimization:

    • Buffer composition: Test various buffers (HEPES, Tris, phosphate) at pH ranges (6.5-8.5)

    • Salt concentration: Optimize NaCl concentration (typically 50-200 mM)

    • Reducing agents: Include DTT or β-mercaptoethanol (1-5 mM) to maintain protease activity

    • Temperature: Conduct assays at physiologically relevant temperatures (30-37°C)

    • Additives: Test effects of glycerol, detergents, or stabilizing agents on activity

  • Detection method selection:

    • SDS-PAGE analysis: For visualizing multiple cleavage products

    • Western blotting: For specific detection of tagged cleavage products

    • HPLC: For quantitative analysis of cleavage product formation

    • Fluorescence-based assays: For continuous real-time monitoring of cleavage reactions

    • Mass spectrometry: For precise identification of cleavage sites

  • Kinetic parameter determination:

    • Perform time-course experiments to determine initial rates

    • Vary substrate concentrations to determine Km and kcat values

    • Use competitive inhibitors to validate specific protease activity

  • Controls and validation:

    • Negative controls: Include catalytically inactive protease mutants

    • Positive controls: Use well-characterized proteases with known activities

    • Inhibitor studies: Validate specificity using protease inhibitors

    • Mutational analysis: Confirm cleavage sites by mutating predicted sites

By systematically optimizing these parameters, researchers can develop robust assays for studying the processing events of astrovirus nonstructural proteins, leading to better understanding of viral replication mechanisms.

What quality control measures should be implemented when working with recombinant Mink astrovirus proteins?

Implementing comprehensive quality control measures is essential when working with recombinant Mink astrovirus proteins to ensure experimental reliability and reproducibility:

  • Purity assessment:

    • SDS-PAGE analysis: Verify protein purity (>90% is generally recommended)

    • Size exclusion chromatography: Assess protein homogeneity and detect aggregation

    • Mass spectrometry: Confirm protein identity and detect post-translational modifications or degradation products

    • Dynamic light scattering: Evaluate size distribution and potential aggregation

  • Functional validation:

    • Enzymatic activity assays: For proteins with catalytic functions, such as the protease domain

    • RNA binding assays: For domains predicted to interact with viral RNA

    • Thermofluor assays: Assess protein stability under various buffer conditions

    • Circular dichroism: Verify proper protein folding and secondary structure content

  • Batch consistency measures:

    • Lot-to-lot comparison: Establish reference standards for comparison between protein batches

    • Documentation: Maintain detailed records of expression conditions, purification procedures, and storage conditions

    • Standardized protocols: Develop and strictly follow standard operating procedures for protein production

  • Storage and stability monitoring:

    • Accelerated stability studies: Test protein activity after incubation at elevated temperatures

    • Freeze-thaw testing: Determine stability after multiple freeze-thaw cycles

    • Long-term storage assessment: Periodically test aliquots stored under recommended conditions (-20°C/-80°C)

    • Proper aliquoting: Prepare single-use aliquots to avoid repeated freeze-thaw cycles

  • Contaminant testing:

    • Endotoxin testing: For proteins intended for cell culture experiments

    • Nuclease treatment: Remove contaminating nucleic acids if present

    • Host cell protein analysis: Specific immunoassays to detect residual host cell proteins

    • Sterility testing: Ensure absence of microbial contamination

Implementing these quality control measures ensures that experimental results obtained with recombinant Mink astrovirus proteins are reliable, reproducible, and biologically relevant, ultimately advancing our understanding of astrovirus biology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.