Recombinant Mink astrovirus 1 Non-structural polyprotein 1A (ORF1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Viral Replication

ORF1 encodes non-structural proteins essential for viral genome replication:

  • Protease activity: Cleaves the polyprotein into functional subunits (e.g., p19, p27) .

  • RNA replication: Associates with viral RNA-dependent RNA polymerase (RdRp) translated via a -1 ribosomal frameshift from ORF1b .

  • VPg precursor: Contains motifs homologous to viral genome-linked proteins (VPg), though experimental validation is pending .

Deletions in ORF1a (e.g., a 57-aa truncation in MAstV-1 compared to human astroviruses) may alter host cell apoptosis regulation and immune evasion .

Production and Applications

Expression and Purification:

  • Produced in E. coli with codon optimization for bacterial systems .

  • Purified via affinity chromatography using the His-tag .

Research Applications:

  • Antigen production: Used to generate antibodies for astrovirus detection .

  • Protease studies: Serves as a substrate for characterizing 3C-like protease activity .

  • Evolutionary analysis: Phylogenetic comparisons highlight MAstV-1’s divergence from human and avian astroviruses (28–54% amino acid identity in ORF1b) .

Comparative Genomic Insights

MAstV-1’s ORF1 shares structural parallels with other astroviruses but exhibits unique features:

  • Genome length: 6,610 bp, shorter than human astroviruses (6,813–7,325 bp) .

  • Recombination events: Evidence of historical recombination with ovine and VA2/human astroviruses .

  • 5' UTR: A 14-nt region, contrasting with the 85-nt UTR of human astroviruses .

Future Directions

  • Functional studies: Elucidate the role of the truncated immunoreactive epitope in MAstV-1 pathogenesis .

  • Therapeutic targeting: Explore ORF1’s protease as a candidate for antiviral drug development .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage condition, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ORF1; Non-structural polyprotein 1A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
663-874
Protein Length
Full Length of Mature Protein
Species
Mink astrovirus 1 (MAstV-1)
Target Names
ORF1
Target Protein Sequence
AKGKTKHKRRIMAAARSGGKRKPGKVWTEEEYKKLLEEGFTRDQLREMAEAAREADDDFD DYEEEKNEVDYPVWSDHDSDEEIDRDWFGQNLPTWSSAWSDFEPELDPDVTKTLPCHLED KFSLKHYIITEADLKHFGQEMKEYMDHLDAVIKTHTEKGKWCPNTNTEEILKDLNAMWFK LNHTMWKNGVAPFMQRKKQKPKNGKRAPKGAQ
Uniprot No.

Target Background

Function
This protein contains the viral protease responsible for cleaving the polyprotein into functional products. It is covalently attached to the 5' extremity of the genomic and subgenomic RNAs.
Database Links

KEGG: vg:1482922

Protein Families
Astroviridae polyprotein 1A family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the basic genomic organization of Mink astrovirus 1?

Mink astrovirus 1, like other astroviruses, contains three open reading frames (ORFs). ORF1a and ORF1b encode non-structural proteins involved in viral replication, while ORF2 encodes the capsid protein. The genome is organized as a positive-sense, single-stranded RNA virus with ORF1a and ORF1b at the 5' end and ORF2 at the 3' end. ORF1a specifically encodes a non-structural polyprotein with a serine-like protease motif that is essential for viral replication .

What are the key functional domains in Mink astrovirus 1 ORF1a protein?

The ORF1a protein of Mink astrovirus 1 contains several critical functional domains: a 3C-like protease motif with a conserved catalytic triad (His, Asp, Ser) that is involved in polyprotein processing; a bipartite nuclear localization signal (NLS) which may facilitate nuclear transport of viral proteins; and regions potentially encoding a viral genome-linked protein (VPg) that may play a role in viral genome replication. The protein also contains a hypervariable region (HVR) that can tolerate insertions, making it valuable for recombinant protein studies .

How does the translation mechanism of ORF1b relate to ORF1a in Mink astrovirus?

ORF1b, which encodes the RNA-dependent RNA polymerase (RdRp), overlaps with ORF1a and is translated through a unique -1 ribosomal frameshift mechanism. This frameshifting event requires a highly conserved heptameric 'slippery sequence' (AAAAAAAC) and a downstream hairpin structure. The frameshift occurs with frequencies up to 25% in cells, resulting in an ORF1a/1b fusion peptide. Following translation, cleavage near the 1a/1b border releases the RdRp, which is essential for viral genome replication .

How does Mink astrovirus 1 ORF1a relate phylogenetically to other astroviruses?

Phylogenetic analyses reveal that Mink astrovirus 1 is closely related to Z. californianus AstroV-HMU-1 (California sea lion astrovirus). Both cluster within the Mamastrovirus 11 species in the genus Mamastrovirus. The RNA-dependent RNA polymerase (RdRp) and serine protease (SP) domains of Mink astrovirus show distinctive evolutionary relationships, clustering in the same branch with Z. californianus AstroV-HMU-1 and forming a lineage distinct from other sea lion astroviruses .

What evidence exists for recombination events in the evolution of Mink astrovirus 1?

Recombination analyses suggest that the genomes of Z. californianus AstroV-HMU-1, VA2/human virus, and Mink astrovirus may have undergone substantial recombination events in the non-structural (NS) protein region. These recombination events likely occurred in the distant past, after which the viruses independently evolved in their respective natural hosts. This evolutionary history has important implications for understanding the diversity and host specificity of astroviruses .

What is the degree of sequence conservation among different Mink astrovirus isolates?

Analysis of Mink astrovirus isolates from different geographic regions shows varying degrees of sequence conservation. Polish isolates demonstrate high similarity to Danish variants (96.4-97.6%, averaging 97.2%), slightly lower similarity to Swedish isolates (94.1-96.4%, averaging 95.64%), and the greatest variation compared to Canadian variants (approximately 7% difference within the analyzed RdRP gene fragment). A unique G3674A polymorphism has been identified in Polish isolates that has not been detected in other sequences deposited in databases .

What is the nucleotide similarity pattern between Mink astrovirus isolates from different countries?

The nucleotide sequence analysis of the RdRP gene fragment reveals specific patterns of similarity and polymorphism among Mink astrovirus isolates from different countries. The following table summarizes these relationships:

CountryAccession numberSimilarity to Polish isolate [%]Polymorphic nucleotides
DenmarkAY196095.196.4G3515A > V301M, G3574A*, T3598C, G3604A, T3628C, C3631T
DenmarkAY196097.197.6G3574A*, T3598C, T3628C, C3631T
SwedenAY196101.195.8C3508T, T3529C, C3547T, A3550G, G3574A*, T3598C, C3631T
SwedenAY196104.195.2T3514A, A3523G, T3529C, C3547T, G3559A, G3574A*, T3577C, T3583C

This data highlights the existence of specific polymorphic nucleotides that differentiate isolates from different geographical regions .

What methods are most effective for detecting Mink astrovirus 1 in clinical samples?

RT-PCR targeting specific regions of the viral genome has proven to be an effective method for detecting Mink astrovirus 1 in clinical samples. Studies have successfully identified the virus in both brain and intestinal samples using this approach. The specificity of the reaction should be confirmed by sequencing the PCR products. For Mink astrovirus detection, primers targeting a 178 bp fragment have been successfully used, with post-sequencing yielding a 170 bp fragment suitable for bioinformatic analysis. When screening for novel astroviruses, gene-specific nested primers targeting the non-structural region have been effective for PCR detection in different sample types including oral, nasal, and anal swabs .

What approaches can be used to express recombinant Mink astrovirus 1 ORF1a for functional studies?

For recombinant expression of Mink astrovirus 1 ORF1a, researchers can employ several approaches. Random transposon-mediated mutagenesis has been successfully used to identify functional domains essential for virus replication and to determine insertion sites in the viral genome that can tolerate nucleotide sequence insertions. Studies have identified at least five sites in ORF1a that can tolerate 15 nt insertions. Epitope tags (such as His, Flag, and HA) can be inserted at these tolerant sites to produce infectious viruses and visualize the ORF1a protein. Additionally, insertion of fluorescent proteins such as improved light-oxygen-voltage (iLOV) protein at the hypervariable region (HVR) has allowed visualization of viral replication by microscopy in the context of a complete viral life cycle .

How can subcellular localization of ORF1a protein be studied in infected cells?

Subcellular localization of the ORF1a protein can be studied using immunofluorescent assays with tagged versions of the protein. Research has shown that Flag-tagged ORF1a protein partially overlaps with capsid and ORF2b proteins in the cytoplasm. This approach allows researchers to track the distribution and potential interactions of the ORF1a protein during viral infection. Additionally, the use of fluorescent reporter proteins, such as iLOV, fused to the hypervariable region (HVR) of ORF1a can enable real-time visualization of the protein in living cells. The recombinant viruses carrying such fluorescent tags have been shown to maintain stability through multiple passages in cell cultures, making them valuable tools for studying protein localization and dynamics .

How can insertion sites within ORF1a be identified and utilized for viral engineering?

Identification of insertion sites within ORF1a can be accomplished through random transposon-mediated mutagenesis, generating a library of insertions throughout the viral genome. This powerful technique has been used to identify sites that can tolerate nucleotide insertions without compromising viral replication. Studies have successfully identified five sites in astrovirus ORF1a that can tolerate 15 nt insertions. The hypervariable region (HVR) of ORF1a has been shown to be particularly amenable to insertions, making it an ideal location for engineering recombinant viruses with reporter genes or epitope tags. These engineered viruses can serve as valuable tools for visualizing viral infection and replication, screening antiviral drugs, and studying virus-host interactions .

What are the implications of the nuclear localization signal in Mink astrovirus ORF1a?

The bipartite nuclear localization signal (NLS) present in Mink astrovirus ORF1a has important implications for understanding viral replication and host interactions. While the exact role of this NLS remains unclear, some reports suggest that viral antigen is observed in the nucleus, while others find that it is excluded. This discrepancy points to a potentially complex role for nuclear localization in the viral life cycle. The NLS may facilitate the transport of viral proteins or ribonucleoprotein complexes to the nucleus, potentially enabling interaction with host nuclear factors or affecting host gene expression. Research into the functionality and significance of this NLS could provide insights into novel aspects of astrovirus replication strategies and potential targets for antiviral interventions .

How do recombinant reporter systems using ORF1a insertions compare in terms of stability and functionality?

When comparing recombinant reporter systems using ORF1a insertions, the stability and functionality vary depending on the insertion site and the size of the insert. Studies investigating the insertion of the improved light-oxygen-voltage (iLOV) gene at different sites within ORF1a (CC, VPg, and HVR) found that only the recombinant virus with iLOV inserted in the HVR was viable. This reporter virus displayed similar growth characteristics to the parental virus, though it produced fewer infectious virus particles. Importantly, the recombinant virus carrying iLOV fused with the HVR of ORF1a protein maintained its stability and continued to show green fluorescence even after 15 passages in cell cultures. This demonstrates that certain insertion sites, particularly the HVR, can accommodate relatively large insertions while maintaining viral viability and genetic stability over multiple replication cycles .

What is the epidemiological distribution of Mink astrovirus variants based on ORF1a sequences?

Epidemiological studies based on ORF1a sequences reveal that Mink astrovirus variants exhibit geographic clustering with distinct genetic signatures. Analysis of isolates from Poland showed 100% similarity between samples from different farms within the country, suggesting local transmission or a common source. When compared internationally, Polish isolates demonstrated highest similarity to Danish variants (97.2% average), intermediate similarity to Swedish isolates (95.64% average), and greatest divergence from Canadian variants (>7% difference). These findings indicate that while there is significant conservation of ORF1a sequences within regional populations, international variants have accumulated distinct polymorphisms, likely reflecting their independent evolution after geographic separation .

What are the detection rates of Mink astrovirus in different sample types?

Studies examining the detection rates of astroviruses in different sample types from infected animals have found variable positivity rates depending on the sample source. In one study of pinnipeds, there was 0% positivity (0/4) for nasal swabs, 14.3% positivity (2/14) for oral swabs, and 28.6% positivity (4/14) for anal swabs. This pattern suggests that anal swabs may provide the highest sensitivity for detecting astrovirus infections, consistent with the primary tropism of these viruses for intestinal epithelial cells. The lower detection rate in oral samples may reflect secondary contamination through the fecal-oral route, while the absence of detection in nasal samples suggests limited respiratory tropism or shedding. These findings have important implications for sampling strategies in diagnostic and surveillance programs for Mink astrovirus .

What are promising approaches for developing antiviral strategies targeting Mink astrovirus ORF1a?

Developing antiviral strategies targeting Mink astrovirus ORF1a presents several promising approaches. The 3C-like protease domain within ORF1a represents a potential target for protease inhibitors, similar to strategies employed against other RNA viruses. The conserved catalytic triad (His, Asp, Ser) could serve as a specific target site for rational drug design. Additionally, the engineering of recombinant viruses with reporter genes inserted in the hypervariable region (HVR) of ORF1a provides an excellent platform for high-throughput screening of antiviral compounds. These fluorescently tagged viruses allow real-time visualization of viral replication inhibition, facilitating rapid identification of effective antiviral candidates. Understanding the functional domains within ORF1a and their interactions with host factors may also reveal novel targets for therapeutic intervention .

How might structural studies of Mink astrovirus ORF1a advance our understanding of viral replication?

Structural studies of Mink astrovirus ORF1a would significantly advance our understanding of viral replication by elucidating the three-dimensional organization of functional domains and their interactions. Determining the crystal structure of the 3C-like protease domain would reveal the precise configuration of the catalytic site and substrate-binding pocket, informing structure-based drug design efforts. Similarly, structural analysis of the putative viral genome-linked protein (VPg) region could confirm its existence and provide insights into its role in initiating viral transcription. Cryo-electron microscopy studies of the entire ORF1a polyprotein or its processed components could illuminate conformational changes associated with proteolytic processing and reveal interaction interfaces with other viral and host proteins. These structural insights would provide a mechanistic framework for understanding the multifunctional nature of ORF1a in the viral life cycle .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.