Recombinant Miopithecus talapoin Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Miopithecus talapoin (Angolan talapoin) (Cercopithecus talapoin)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTATPHLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVTLLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVLFSMLFI AYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function

This receptor binds to α, β, and γ-MSH and ACTH. Its activity is G protein-mediated, activating adenylate cyclase. It regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow) pigments, by modulating cAMP signaling in melanocytes.

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural homology between Miopithecus talapoin MC1R and human MC1R?

Miopithecus talapoin MC1R shares significant sequence homology with human MC1R, as both belong to the melanocortin receptor family of G-protein coupled receptors (GPCRs). Like human MC1R, the talapoin monkey receptor features seven transmembrane domains with extracellular N-terminus and intracellular C-terminus domains critical for signaling.

Researchers typically analyze homology through sequence alignment tools, identifying conserved domains particularly in the transmembrane regions and binding pockets. When working with recombinant MC1R, it's advisable to compare key functional residues such as those corresponding to human variants D84E, R142H, R151C, I155T, R160W, and D294H, which have known impacts on receptor function in humans . These comparative analyses can inform the design of chimeric receptors for structure-function studies.

What expression systems are most effective for recombinant Miopithecus talapoin MC1R production?

For functional studies of recombinant MC1R, mammalian expression systems typically yield the most native-like receptor conformation and post-translational modifications. Established protocols employ:

  • HEK293 cells with double Twin Strep tag modifications for purification, as demonstrated in human MC1R studies

  • E. coli periplasmic expression systems for nanobody production against MC1R

  • Virus-like particles (VLPs) for presenting active-state stabilized MC1R in conformational studies

When establishing an expression system, researchers should verify receptor functionality through cAMP signaling assays (e.g., Lance Ultra HTRF assay) . The addition of tags such as Twin Strep facilitates purification while maintaining receptor functionality. For structural studies, stability-enhancing modifications may be necessary, such as the MC1R-β2AR chimera approach where C-terminus and intracellular loops from another GPCR (β2AR) are grafted onto MC1R .

How can MC1R variants be categorized in experimental models?

MC1R variants can be systematically categorized based on their functional impact on receptor activity. The established classification system includes:

  • Wild-type (WT or "w") - normal receptor function

  • "r" variants - partial loss of receptor function (e.g., V60L, V92M, R163Q)

  • "R" variants - significant loss of receptor function (e.g., D84E, R142H, R151C, I155T, R160W, D294H)

This classification allows for the development of a scoring system where:

  • Wild-type alleles are scored as 0

  • "r" variants are scored as 1

  • "R" variants are scored as 2

For experimental models, researchers can generate sum scores across both alleles to predict functional impact . When recombinantly expressing these variants, verification of functional alterations should be performed using cAMP assays, G-protein recruitment assays, or conformational sensors that monitor receptor activation states.

What quantitative methods accurately measure recombinant MC1R expression levels?

Several complementary methods can be employed to quantify recombinant MC1R expression:

  • Quantitative Immunofluorescence: This technique allows precise measurement of MC1R protein levels in cell cultures or tissue samples. Studies have successfully employed this approach to demonstrate stepwise elevation of MC1R expression across different stages of melanoma progression .

  • Western Blotting: For recombinant MC1R, western blotting with densitometric analysis provides reliable protein quantification when calibrated against known standards.

  • Flow Cytometry: For cell-surface expression analysis, flow cytometry with fluorescently-labeled antibodies or ligands offers single-cell resolution.

  • ELISA: Particularly useful for solubilized recombinant receptors, allowing high-throughput quantification.

For all methods, validation with both positive and negative controls is essential, as is cross-validation between techniques for novel MC1R variants or species-specific forms.

How do MC1R variants affect downstream signaling pathways in experimental models?

MC1R variants exhibit differential effects on downstream signaling pathways that can be systematically evaluated through the following experimental approaches:

  • cAMP Signaling: MC1R primarily signals through Gαs-mediated adenylyl cyclase activation. Functional assays such as HTRF can assess cAMP production in response to receptor activation . Researchers should establish dose-response curves with established agonists (e.g., α-MSH or setmelanotide) comparing wild-type versus variant receptors.

  • G-protein Coupling Efficiency: ConfoSensor assays monitor nanobody-induced recruitment of G-protein mimetics (e.g., Cb80) to MC1R, providing a measure of receptor activation . For recombinant talapoin MC1R, parallel analysis of wild-type and variants can reveal coupling differences.

  • DNA Repair Pathways: MC1R signaling affects DNA repair mechanisms, particularly through APEX1 expression, which is important in DNA repair responses to reactive oxygen species . Experimental models should measure APEX1 expression levels and activity in systems expressing different MC1R variants.

  • Cell Cycle Effects: MC1R signaling has been suggested to affect expression of cell cycle regulators (CDKN2A, CDK2) . Researchers can compare cell cycle progression and associated protein expression in cells expressing variant forms of MC1R.

  • Apoptosis Regulation: Studies indicate MC1R variants influence apoptosis regulation through proteins like BCL2 . Apoptosis assays (Annexin V/PI staining, caspase activity) can quantify these effects.

For comprehensive analysis, researchers should examine multiple signaling pathways simultaneously, as MC1R variants may have pathway-specific effects. Data should be organized in comparative tables showing fold-changes in signaling outputs relative to wild-type receptor.

What are the challenges in developing conformation-specific antibodies for MC1R structural studies?

Developing conformation-specific antibodies for MC1R presents several technical challenges that researchers should address through specific methodological approaches:

  • Receptor Conformational Stabilization: MC1R exists in multiple conformational states (inactive, active, intermediate). For antibody development, conformational stabilization is critical. Researchers have successfully employed genetic fusion approaches where a ConfoBody (e.g., Cb80) is fused to the C-terminus of an MC1R-β2AR hybrid GPCR to stabilize the active conformation .

  • Immunization Strategies: Traditional immunization with purified receptors often fails to generate conformation-specific antibodies. Alternative approaches include:

    • Virus-like particles (VLPs) presenting conformationally stabilized MC1R

    • In vivo matured nanobody repertoires from immunized llamas

    • Phage display selection on conformationally locked receptors

  • Screening for Conformation Specificity: Robust screening assays are essential, such as:

    • ConfoSensor assays that monitor nanobody-induced recruitment of G-protein mimetics

    • Competitive binding assays against known state-specific ligands

    • Functional assays measuring receptor activation (cAMP production)

  • Cross-species Reactivity Concerns: Antibodies raised against human MC1R may not recognize species-specific epitopes in Miopithecus talapoin MC1R. Parallel screening against both species' receptors is recommended to identify broadly reactive or species-specific antibodies.

When developing conformation-specific antibodies for MC1R, researchers should evaluate both recognition specificity and functional modulation capabilities, as some antibodies may recognize but not alter receptor conformation, while others may act as allosteric modulators.

How can researchers effectively study gene-phenotype associations of MC1R variants across species?

Cross-species studies of MC1R variants require systematic approaches to correlate genotypic variation with phenotypic outcomes. Methodological recommendations include:

  • Comprehensive Genotyping: Full sequencing of the MC1R coding region using standardized protocols. For human studies, TaqMan assays with appropriate primers and probes achieve high call rates (>99%) . For cross-species work, conserved primer sites should be identified for consistent amplification.

  • Variant Classification Framework: Apply consistent classification frameworks across species, such as the established system for human MC1R variants:

    • R variants (D84E, R142H, R151C, I155T, R160W, D294H) - high impact

    • r variants (V60L, V92M, R163Q) - moderate impact

  • Genetic Ancestry Analysis: Include ancestry informative markers in genotyping panels to account for population stratification effects. In human studies, European, African, and Native American genetic ancestry proportions significantly influence interpretation of MC1R effects .

  • Quantitative Phenotyping: Use standardized, objective measures of phenotypes rather than self-reported data when possible. For pigmentation studies, spectrophotometric measures provide more reliable data than categorical classifications.

  • Statistical Analysis Framework: Apply multivariable regression models adjusting for key covariates. For example, in human studies examining MC1R variants and melanoma risk, models adjust for:

    • Sex

    • Melanoma body site

    • Histopathological subtype

    • Hair color

    • Skin type

This table summarizes findings from a cross-species study design on MC1R variants:

SpeciesCommon MC1R VariantsFrequency (%)Associated PhenotypesMethodology
HumanR160W21%Melanoma risk, reduced tanning abilityTaqMan genotyping, multivariable regression
HumanR151C15%Melanoma risk, red hairSequencing, case-control comparison
M. talapoin[Hypothetical variants][Data needed][Data needed]Full gene sequencing, comparative analysis

What functional assays best characterize MC1R pharmacological responses in vitro?

Multiple complementary assays should be employed to comprehensively characterize MC1R pharmacological responses:

  • cAMP Accumulation Assays: The primary signaling pathway of MC1R involves Gαs coupling and cAMP production. HTRF-based assays (e.g., Lance Ultra) provide high sensitivity for detecting cAMP changes in MC1R-expressing cells . Dose-response curves with agonists (α-MSH, setmelanotide) should be generated for EC50 determination.

  • G-protein Recruitment Assays: ConfoSensor assays monitor recruitment of G-protein mimetics (Cb80) to activated receptors, providing direct measurement of receptor conformational changes associated with activation . This approach distinguishes ligands that induce different active conformations.

  • β-arrestin Recruitment: BRET-based assays measuring β-arrestin recruitment can identify biased ligands that preferentially activate non-G-protein pathways.

  • Receptor Internalization: Fluorescence-based trafficking assays track receptor internalization following agonist exposure, providing insights into desensitization mechanisms.

  • Competitive Binding Assays: Radioligand or fluorescent ligand displacement assays determine binding affinities (Ki values) independent of signaling outcomes.

For recombinant Miopithecus talapoin MC1R, establishing a baseline pharmacological profile with known human MC1R ligands provides comparative data for interpreting species-specific responses. When testing novel compounds, parallel assays with human and talapoin MC1R enable identification of species-selective ligands.

How should researchers design MC1R-targeting nanobodies for structural and functional studies?

Nanobody development for MC1R studies requires careful design and screening protocols:

  • Immunization Strategy:

    • Immunize llamas with engineered active-state MC1R conformations, such as MC1R-β2AR chimeras fused to conformational stabilizers (ConfoBody Cb80)

    • Monitor immune response through serum analysis before nanobody library generation

  • Library Construction and Screening:

    • Generate phage display libraries from peripheral blood lymphocytes of immunized animals

    • Conduct selections on virus-like particles (VLPs) harboring conformationally stabilized MC1R

    • Implement negative selection steps to remove non-specific binders

  • Functional Characterization:

    • Screen periplasmic extracts in ConfoSensor assays to identify nanobodies capable of inducing G-protein mimetic recruitment

    • Validate candidates in cAMP signaling assays using wild-type human MC1R

    • Approximately 26% of nanobody clusters may show G-protein recruitment capability

  • Structural Characterization:

    • Purify promising candidates for crystallography or cryo-EM studies with receptor

    • Employ epitope mapping through mutagenesis to define binding interfaces

    • Analyze sequence clusters for structure-function relationships

For Miopithecus talapoin MC1R-specific nanobodies, cross-reactivity testing with human MC1R identifies conserved binding epitopes versus species-specific regions. Successful nanobodies can be used as crystallization chaperones for structural studies or as research tools to stabilize specific receptor conformations.

What are the key considerations for studying MC1R expression patterns in tissue samples?

To accurately study MC1R expression patterns in tissue samples, researchers should follow these methodological guidelines:

  • Sample Selection and Preparation:

    • Use tissue microarrays for high-throughput analysis of multiple samples

    • Include appropriate controls (positive, negative, and gradient standards)

    • Consider analyzing different disease stages when relevant (e.g., benign nevi, primary melanoma, metastatic melanoma)

  • Quantitative Techniques:

    • Employ quantitative immunofluorescence for precise expression measurement

    • Use immunohistochemistry for morphological context and clinical correlation

    • Apply digital image analysis with standardized acquisition parameters

  • Expression Analysis Framework:

    • Establish scoring systems based on staining intensity and percentage of positive cells

    • Compare expression levels across different sample types and disease stages

    • Correlate with clinical parameters (e.g., tumor depth, ulceration, survival)

Research has demonstrated a stepwise elevation of MC1R expression during melanoma progression, with higher expression in:

  • Deeper (>1 mm) primary lesions

  • Ulcerated lesions

  • Mucosal melanomas compared to cutaneous melanomas

MC1R expression patterns should be analyzed in multivariate models that include relevant clinicopathological parameters. This approach has revealed associations between high MC1R expression and shorter survival in both primary and metastatic tumors .

How can researchers effectively analyze the impact of MC1R variants on survival outcomes in disease models?

Analyzing MC1R variant impacts on survival outcomes requires rigorous statistical and methodological approaches:

  • Study Design Framework:

    • Establish well-defined cohorts with adequate sample size (e.g., >1,000 subjects)

    • Ensure complete clinical follow-up from diagnosis date until a defined endpoint

    • Consider demographic and phenotypic variables as potential confounders

  • Genotyping Methods:

    • Sequence the entire MC1R coding region using standardized protocols

    • Classify variants according to established criteria (R vs. r variants)

    • Include quality control measures with high genotyping call rates (>99%)

  • Statistical Analysis Approach:

    • Apply both univariable and multivariable Cox regression models

    • Adjust for relevant covariates (age, sex, disease-specific variables)

    • Consider stratified analyses for important subgroups (e.g., age, sex)

  • Men carrying any MC1R variant had worse survival than those with wild-type MC1R (HR=2.05; 95% CI=1.05-4.01; p=0.035 in multivariable model)

  • Hazard ratios were significantly higher among older (≥50) patients (HR=4.14; 95% CI=2.20-7.80; p<0.001)

  • Men generally had worse survival compared to women (HR=1.65; 95% CI=1.08-2.52; p=0.021)

These findings suggest MC1R effects on disease course may vary by population and sex, highlighting the importance of stratified analyses when studying MC1R variants and survival outcomes.

What is the prevalence of MC1R variants across different population groups?

MC1R variant prevalence shows significant variation across populations, with important implications for research design. This data table summarizes key findings from recent studies:

PopulationMC1R Risk CategoryPrevalence (%)Notable VariantsSource
Puerto RicanLow risk (wild-type)45.6%-
Puerto RicanMedium risk (single r variant)30.1%-
Puerto RicanHigh risk (R variants or multiple r)24.4%-
Hispanic (Tampa, FL)Low risk43.0%-
Hispanic (Tampa, FL)Medium risk38.0%-
Hispanic (Tampa, FL)High risk19.0%-
PolishR160W carrier21%R160W
European populationsR variant carriersVaries by ancestryR151C, R160W, D294H

When designing studies with recombinant Miopithecus talapoin MC1R, researchers should consider these human population differences for comparative analyses. The prevalence of MC1R variants remains consistent across different genetic ancestry backgrounds within Hispanic populations, with high-risk alleles present even among individuals with stronger African or Native American genetic ancestry .

How does MC1R expression correlate with disease progression in melanoma models?

Disease StageRelative MC1R ExpressionClinical CorrelationsMethodologySource
Benign neviBaseline-Quantitative immunofluorescence
Primary melanomaElevated compared to neviHigher in lesions >1mm depthQuantitative immunofluorescence
Primary melanomaHigher in ulcerated lesionsAssociated with shorter survivalQuantitative immunofluorescence
Metastatic melanomaHighest expressionAssociated with shorter survivalQuantitative immunofluorescence
Mucosal melanomaHigher than cutaneous-Quantitative immunofluorescence

These findings demonstrate a stepwise elevation of MC1R expression through melanoma progression stages, with higher expression correlating with aggressive disease features . For researchers working with recombinant MC1R, these expression patterns provide important context for translational studies and potential therapeutic applications targeting this receptor.

How do MC1R variants influence melanoma risk in different age groups?

The relationship between MC1R variants and melanoma risk shows age-dependent patterns that are particularly relevant for pediatric and adolescent populations:

Age GroupMC1R VariantOdds Ratio (95% CI)Comparison GroupAdjustmentsSource
≤20 yearsAny R variant1.54 (1.02-2.33)ControlsStudy location
≤20 yearsR/R genotype1.80 (0.96-3.36)ControlsStudy location
≤18 yearsAny R variant1.84 (1.13-3.00)ControlsStudy location
≤14 yearsAny R variant2.12 (1.14-3.94)ControlsStudy location
AdultsAny R variant1.17 (0.92-1.49)ControlsStudy location

These findings indicate that MC1R R variants have a stronger association with melanoma risk in younger populations, with increasing strength of association as age decreases . The odds ratio for any R variant reaches 2.12 in children ≤14 years, compared to 1.17 in adults. This suggests that MC1R genetic testing may have particular value for risk assessment in pediatric populations.

What are the most promising applications for recombinant Miopithecus talapoin MC1R in comparative receptor biology?

Recombinant Miopithecus talapoin MC1R represents an important comparative model for understanding melanocortin receptor evolution and function. Key research applications include:

  • Evolutionary Conservation Studies: Comparing binding domains and signaling mechanisms between primate species can identify conserved versus species-specific functions of MC1R.

  • Receptor Specificity Research: Differential ligand responses between human and talapoin MC1R can reveal structural determinants of ligand selectivity.

  • Conformational Dynamics: Comparative analysis of receptor activation mechanisms using tools like conformation-specific nanobodies .

  • Translational Applications: Development of species-selective ligands for research tools or therapeutic applications.

Future research should focus on generating comprehensive structural and functional comparisons between human and non-human primate MC1R variants, particularly focusing on regions that influence disease risk in humans. These comparative studies can provide evolutionary context for understanding the role of MC1R in human health and disease.

What methodological advances are needed to resolve contradictions in MC1R variant functional studies?

Current research on MC1R variants reveals several contradictions that require methodological advances to resolve:

  • Population-Specific Effects: Studies show MC1R variants may have different effects across populations. For example, variants associated with worse survival in men but not in the entire cohort in Polish populations . Standardized multi-ethnic study designs with sufficient power for subgroup analyses are needed.

  • Sex-Specific Effects: Evidence suggests sex-specific effects of MC1R variants on melanoma survival . Studies should be designed with adequate power for sex-stratified analyses and investigation of hormonal interactions.

  • Context-Dependent Signaling: MC1R signaling effects on DNA repair, cell cycle, and apoptosis may depend on cellular context . Development of isogenic cell models with controlled genetic backgrounds would help isolate variant-specific effects.

  • Improved Functional Classification: Current R/r classification may be oversimplified. High-throughput functional profiling across multiple signaling pathways could provide more nuanced classification of variants.

  • Standardized Recombinant Expression Systems: Establishing standard protocols for recombinant MC1R expression would improve cross-study comparability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.