Recombinant Mirza coquereli NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a synthetic version of the mitochondrial protein encoded by the MT-ND4L gene in Coquerel’s mouse lemur (Mirza coquereli). This protein is a core subunit of Complex I (NADH dehydrogenase), a critical enzyme in the mitochondrial electron transport chain (ETC) responsible for transferring electrons from NADH to ubiquinone and pumping protons across the inner mitochondrial membrane .
Function: Integral to oxidative phosphorylation, enabling ATP production via proton gradient formation .
Clinical Relevance: While human MT-ND4L mutations are linked to Leber’s Hereditary Optic Neuropathy (LHON), the recombinant Mirza coquereli variant is primarily used in research to study mitochondrial function and disease mechanisms .
The MT-ND4L gene in Mirza coquereli encodes a 98-amino acid protein (partial sequence: MPSISINITLAFTTALLGmLMFRSHMMSSLLCLEGMmLSMFILSTLIILNVQLTMSFMMP ILLLVFAACEAAIGLALLVMISNTYGLDYIQNLNLLQC) . Notably, the gene overlaps with MT-ND4 in other species, a feature conserved to optimize mitochondrial DNA packing .
Mitochondrial Function Studies: Investigating Complex I assembly and electron transport efficiency .
Disease Modeling: Exploring mitochondrial dysfunction in LHON and metabolic disorders .
Structural Biology: Analyzing transmembrane domain interactions via X-ray crystallography or cryo-EM .
MT-ND4L is part of the minimal catalytic core of Complex I, stabilizing the transmembrane region and facilitating proton pumping . Mutations in this subunit disrupt electron transfer, impairing ATP synthesis .
Low Solubility: Hydrophobic transmembrane domains require specialized detergents for solubilization .
Post-Translational Modifications: Phosphorylation or lipidation may affect functional assays in vitro .
NADH-ubiquinone oxidoreductase chain 4L functions as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. MT-ND4L is specifically part of the enzyme membrane arm that is embedded in the lipid bilayer and is critically involved in proton translocation across the inner mitochondrial membrane . This proton translocation is essential for generating the electrochemical gradient that drives ATP synthesis, making MT-ND4L vital for cellular energy production.
While specific structural data on Mirza coquereli MT-ND4L is limited, comparative analysis with other mammalian species reveals that MT-ND4L is highly conserved but contains species-specific variations. For example, the mitred leaf monkey (Presbytis melalophos) MT-ND4L consists of 98 amino acids with a sequence that shows a characteristic hydrophobic profile consistent with its membrane-embedded nature . Similar NADH-ubiquinone oxidoreductase chain 4L proteins in other species such as donkey (Equus asinus) and wild yak (Bos mutus grunniens) also consist of 98 amino acids with species-specific variations in their amino acid sequences, particularly in regions not critical for function . Detailed structural comparison would require alignment of the Mirza coquereli sequence with these known sequences to identify conserved domains and species-specific variations.
The MT-ND4L gene in Mirza coquereli, like in most mammals, is encoded in the mitochondrial genome. Based on comparative data from other primates, the gene typically does not contain introns. In some species, the ND4L gene is positioned adjacent to or overlapping with the ND4 gene. In genomic studies of lemurs, including analysis that covered Mirza coquereli, the PAST fragment (a mitochondrial DNA region) includes the NADH-dehydrogenase subunits 3, 4L, and 4 (ND3, ND4L, and ND4), as well as the tRNAGly, tRNAArg, tRNAHis, tRNASer, and partial tRNALeu genes . This organization allows for the amplification of the complete MT-ND4L gene for phylogenetic and comparative studies, which has been crucial for taxonomic classification of lemur species.
Expression of recombinant MT-ND4L presents several challenges due to its hydrophobic nature and mitochondrial origin. Recommended methodology includes:
Expression System Selection: For membrane proteins like MT-ND4L, specialized expression systems such as E. coli C41(DE3) or C43(DE3) strains (specifically designed for membrane proteins) may yield better results.
Vector Design: Including a fusion tag (His6, GST, or MBP) can improve solubility and facilitate purification. A TEV or PreScission protease cleavage site should be incorporated for tag removal.
Expression Conditions:
Induction at lower temperatures (16-20°C)
Extended expression times (16-24 hours)
Lower IPTG concentrations (0.1-0.5 mM)
Addition of membrane-stabilizing agents (e.g., glycerol at 5-10%)
Codon Optimization: Adapting the Mirza coquereli MT-ND4L sequence to the expression host's codon preference is critical for improving expression levels.
Detergent Selection: Initial solubilization and purification should be tested with various detergents (CHAPS, DDM, or Triton X-100) to determine optimal extraction efficiency while maintaining protein stability .
Verification of structural integrity for recombinant MT-ND4L should employ multiple complementary techniques:
SDS-PAGE and Western Blotting: Initial verification of protein size and purity.
Circular Dichroism (CD) Spectroscopy: To assess secondary structure composition and confirm proper folding. For MT-ND4L, expect predominantly alpha-helical structure with characteristic minima at 208 and 222 nm.
Size Exclusion Chromatography: To evaluate oligomeric state and homogeneity.
Mass Spectrometry: For precise molecular weight determination and verification of post-translational modifications. Electrospray mass spectrometry has been successfully used to identify novel subunits of bovine complex I and can be adapted for verification of recombinant MT-ND4L .
Functional Assays: Measuring NADH:ubiquinone oxidoreductase activity in reconstituted systems or upon incorporation into membrane mimetics (liposomes or nanodiscs).
Thermostability Assays: Using differential scanning fluorimetry to assess protein stability and identify optimal buffer conditions.
Structural Analysis: Limited proteolysis to evaluate domain organization and stability .
To study MT-ND4L interactions with other Complex I subunits, the following methodologies are recommended:
Crosslinking Coupled with Mass Spectrometry: This approach can capture transient interactions between MT-ND4L and neighboring subunits. Use membrane-permeable crosslinkers like DSS or DSG, followed by tryptic digestion and MS/MS analysis to identify crosslinked peptides.
Co-immunoprecipitation (Co-IP): Using antibodies against MT-ND4L or potential interacting partners to pull down protein complexes, followed by Western blotting or mass spectrometry analysis.
Blue Native PAGE: For analyzing intact complex I assembly and subcomplexes containing MT-ND4L.
Proximity Labeling: Techniques such as BioID or APEX2 can be employed by fusing these enzymes to MT-ND4L to identify neighboring proteins in the native environment.
Yeast Two-Hybrid Membrane System (MYTH): Adapted for membrane proteins to detect binary interactions.
Surface Plasmon Resonance (SPR): For quantitative analysis of binding kinetics between purified MT-ND4L and other complex I components.
Reconstitution Experiments: Systematic reconstitution of complex I subunits to assess functional interdependencies and assembly requirements .
The evolution of MT-ND4L across lemur species provides valuable insights into Mirza coquereli's evolutionary history:
Phylogenetic Analysis: Studies utilizing the PAST fragment (which includes ND4L) have been instrumental in elucidating lemur phylogeny. For instance, molecular genetic analyses of sportive lemurs (genus Lepilemur) have utilized this region for taxonomic classification and phylogenetic reconstruction .
Nucleotide Substitution Patterns: Comparisons of MT-ND4L sequences across lemur species reveal patterns of evolutionary conservation and change. Nonsynonymous to synonymous substitution ratio (dN/dS) analysis can identify sites under positive selection, which may relate to functional adaptations.
Biogeographic Distribution: Mitochondrial DNA analysis, including MT-ND4L, has contributed to understanding the biogeographic distribution of lemur species across Madagascar. This includes identifying barriers to gene flow such as rivers and mountains that have shaped lemur evolution .
Divergence Dating: Molecular clock analyses using MT-ND4L and other mitochondrial genes help estimate divergence times between Mirza coquereli and related lemur species.
Conservation Implications: Understanding the genetic uniqueness of Mirza coquereli populations through MT-ND4L analysis contributes to conservation planning and prioritization.
The evolutionary analysis of MT-ND4L has particular significance because in some species of lemurs (e.g., Chlamydomonas reinhardtii), the ND4L gene has been transferred from the mitochondrial to the nuclear genome, unlike in most mammals where it remains mitochondrially encoded . This makes the gene particularly interesting for studying mitochondrial gene transfer events across evolutionary history.
The comparison between nuclear-encoded and mitochondrial-encoded ND4L proteins reveals several key functional and structural differences:
| Characteristic | Mitochondrial-encoded ND4L | Nuclear-encoded ND4L |
|---|---|---|
| Hydrophobicity | Highly hydrophobic | Lower hydrophobicity to facilitate import |
| Signal Sequences | Absent | Contains mitochondrial targeting sequence |
| Codon Usage | Mitochondrial genetic code | Nuclear genetic code |
| Post-translational Processing | Minimal | Requires processing of targeting sequence |
| Expression Regulation | Coordinated with mitochondrial biogenesis | Integrated with nuclear gene expression programs |
| Evolutionary Rate | Generally faster | Generally slower |
Studies of algal species like Chlamydomonas reinhardtii, where ND4L is nuclear-encoded (NUO11), demonstrate that nuclear-encoded versions typically show reduced hydrophobicity compared to mitochondrially-encoded counterparts, which facilitates protein import into mitochondria . Additionally, nuclear-encoded ND4L proteins acquire features that facilitate their expression and proper import into mitochondria.
The expression suppression of nuclear-encoded NUO3 and NUO11 genes (homologs of ND3 and ND4L) through RNA interference demonstrated that the absence of these polypeptides prevents the assembly of the entire 950-kDa complex I and eliminates enzyme activity, highlighting their essential role regardless of genomic origin .
Researchers can effectively use MT-ND4L sequence data in molecular phylogenetic studies of lemurs through the following methodological approaches:
Primer Design and Amplification Strategy: The PAST fragment, which includes ND4L, can be amplified using established primer sets under specific PCR conditions: 94°C for 30s, 47°C for 45s, 72°C for 45s for 34 cycles. To minimize inadvertent amplification of nuclear insertions or mitochondrial pseudogenes, researchers should amplify the mitochondrial DNA regions as intersecting or overlapping segments .
Multiple Sequence Alignment: After obtaining MT-ND4L sequences, researchers should use algorithms such as MUSCLE or MAFFT for accurate alignment, followed by manual refinement to ensure proper codon alignment.
Model Selection: Before phylogenetic analysis, determine the best-fit nucleotide substitution model using programs like MrModeltest or jModelTest to ensure accurate tree reconstruction .
Phylogenetic Analysis Methods:
Haplotype Network Analysis: Construct minimum spanning networks of lemur haplotypes to visualize relationships between closely related sequences and identify missing intermediates .
Taxonomic Applications: MT-ND4L sequence data has proven valuable for identifying cryptic species and resolving taxonomic uncertainties in lemurs, as demonstrated by studies that have led to the description of new species based on genetic divergence patterns .
Researchers have successfully used this approach to understand the biogeographic distribution of lemur species across Madagascar, particularly in relation to major river systems and ecological barriers that have influenced speciation .
Assessing MT-ND4L function within Complex I requires multiple complementary approaches:
Enzyme Activity Assays:
NADH:ubiquinone oxidoreductase activity measurement using artificial electron acceptors (decylubiquinone or coenzyme Q1)
Rotenone-sensitive and rotenone-insensitive activity differentiation
Spectrophotometric monitoring of NADH oxidation at 340 nm
Oxygen consumption measurements using polarography or oxygen-sensitive fluorescent probes
Proton Pumping Assessment:
pH-sensitive fluorescent dyes (ACMA, pyranine) to monitor proton translocation
Potentiometric measurements with pH electrodes
Reconstitution of purified complex I into liposomes for controlled proton gradient studies
Structural Integrity Analysis:
Blue Native PAGE to assess intact Complex I assembly
Western blotting to verify MT-ND4L incorporation into Complex I
Immunoprecipitation of Complex I followed by proteomic analysis
Mutagenesis Studies:
Site-directed mutagenesis of conserved residues in MT-ND4L
Functional complementation assays in knockout/knockdown systems
Analysis of disease-associated mutations and their biochemical consequences
Inhibitor Sensitivity Profiling:
Distinguishing between assembly and catalytic defects caused by MT-ND4L mutations requires systematic analysis:
Assembly Analysis:
Blue Native PAGE combined with Western blotting to visualize Complex I assembly intermediates
Immunoprecipitation of assembly factors (NDUFAF1-6) to assess interaction with mutant MT-ND4L
Pulse-chase experiments to track the kinetics of Complex I assembly
Analysis of subcomplexes accumulation patterns specific to different assembly defects
Activity Measurements:
Normalized activity assays (activity per amount of fully assembled Complex I)
Spectroelectrochemical analysis of electron transfer rates
EPR spectroscopy to assess iron-sulfur cluster incorporation and function
Proton pumping efficiency measurements in reconstituted systems
Systematic Approach to Differentiation:
First, quantify the amount of fully assembled Complex I
Then measure activity normalized to assembled complex
If normalized activity is maintained but total activity is reduced, the defect is primarily in assembly
If normalized activity is reduced, the defect affects catalytic function
If both are affected, the mutation impacts both processes
Complementation Studies:
For comprehensive analysis of MT-ND4L sequences and mutation effects, researchers should utilize the following bioinformatic tools and resources:
Sequence Analysis and Evolutionary Conservation:
BLAST and HMMER for sequence similarity searches
ConSurf for evolutionary conservation analysis
Clustal Omega, MUSCLE, or T-Coffee for multiple sequence alignment
MEGA X for phylogenetic analysis and evolutionary rate calculation
Structural Prediction and Analysis:
TMHMM, TOPCONS, or Phobius for transmembrane domain prediction
AlphaFold or RoseTTAFold for structure prediction
PyMOL or UCSF Chimera for structural visualization and analysis
HADDOCK or MDockPP for protein-protein docking (to predict interactions with other Complex I subunits)
Mutation Effect Prediction:
SIFT, PolyPhen-2, or PROVEAN for assessing mutation pathogenicity
MutPred for predicting molecular mechanisms of disease
SNAP2 or INPS for stability change prediction
MItoNuclear Coevolution Assessment (MINCA) for analyzing mitonuclear compatibility
Specialized Resources:
MitoMap for mitochondrial genome variation database
MitImpact for pathogenicity prediction of mitochondrial variants
UniProt for protein annotation and conservation data
KEGG for metabolic pathway integration
Pfam and InterPro for domain prediction and annotation
Integration and Visualization:
Recombinant MT-ND4L provides powerful tools for studying Complex I-related mitochondrial diseases:
In Vitro Reconstitution Systems:
Reconstitution of wild-type and mutant MT-ND4L into liposomes or nanodiscs
Comparison of proton pumping efficiency and electron transfer rates
Assessment of ROS production by different MT-ND4L variants
Structure-function relationship studies to map critical residues
Cell-Based Models:
Creation of MT-ND4L knockout cell lines using mitochondria-targeted CRISPR systems
Complementation with wild-type or mutant recombinant MT-ND4L
Phenotypic rescue assays to assess functional recovery
Live-cell imaging to track mitochondrial dynamics and function
Patient-Derived Mutation Analysis:
Biochemical characterization of patient-specific MT-ND4L mutations
Development of high-throughput screens for compounds that can rescue mutant phenotypes
Structure-based drug design targeting MT-ND4L interaction sites
Biotechnological Applications:
Development of MT-ND4L-based biosensors for mitochondrial function
Creation of diagnostic tools for rapid assessment of MT-ND4L mutations
Design of peptide inhibitors or activators targeting specific MT-ND4L domains
Evolutionary Medicine Approaches:
Incorporating recombinant MT-ND4L into functional Complex I presents several challenges, with corresponding methodological solutions:
| Challenge | Solution Approach | Technical Details |
|---|---|---|
| Hydrophobicity | Detergent optimization | Systematic screening of detergents (DDM, LMNG, GDN) at various concentrations; use of amphipols or SMALPs for enhanced stability |
| Proper folding | Membrane mimetics | Reconstitution into nanodiscs with defined lipid composition; use of lipid cubic phase for crystallization |
| Assembly with other subunits | Stepwise reconstitution | Systematic addition of purified subunits or subcomplexes; monitoring assembly by BN-PAGE or cryo-EM |
| Stability of the complex | Chemical crosslinking | GraFix method combining glycerol gradient with mild crosslinking; site-specific crosslinking guided by structural data |
| Functionality verification | Activity assays | Tailored assays measuring electron transfer and proton pumping in the reconstituted complex |
| Structural determination | Cryo-EM optimization | Sample homogeneity verification by negative stain EM before cryo-EM; careful screening of grid preparation conditions |
| Expression of multiple subunits | Multi-protein expression systems | MultiBac system for simultaneous expression of multiple Complex I subunits in insect cells |
| Post-translational modifications | Eukaryotic expression systems | Use of mammalian or insect cell expression systems to ensure proper modifications |
These methodological approaches have been successfully applied in structural studies of other membrane protein complexes and can be adapted for Complex I reconstitution with recombinant MT-ND4L .
The unique evolutionary history of ND4L, with examples of both mitochondrial and nuclear encoding across different species, provides an excellent model for studying mitochondrial gene transfer:
Comparative Genomic Approaches:
Systematic identification of species with nuclear versus mitochondrial ND4L
Characterization of flanking sequences to understand insertion mechanisms
Dating of gene transfer events through molecular clock analyses
Identification of intermediate stages of gene transfer across taxa
Expression Regulation Studies:
Analysis of transcriptional and translational regulation differences
Comparison of codon optimization between nuclear and mitochondrial versions
Investigation of nuclear transcription factors that regulate nuclear-encoded ND4L
Assessment of coordination between nuclear and mitochondrial gene expression
Protein Import and Processing Analysis:
Characterization of mitochondrial targeting sequences in nuclear-encoded ND4L
Comparative analysis of import efficiency across species
Identification of chaperones and processing peptidases involved
In vitro import assays comparing nuclear-encoded ND4L variants
Functional Evolutionary Studies:
Hydrophobicity comparison between nuclear and mitochondrial ND4L homologs
Functional complementation experiments across species
Measurement of Complex I assembly efficiency with nuclear versus mitochondrial ND4L
Analysis of mitonuclear co-evolution following gene transfer
Experimental Models:
Creation of artificial gene transfer models using Chlamydomonas reinhardtii as a reference
RNA interference experiments to suppress nuclear-encoded ND4L expression
Forced expression of mitochondrial ND4L from the nucleus with targeting sequences
Assessment of fitness consequences of different genetic architectures
Working with recombinant MT-ND4L presents several technical challenges that can be systematically addressed:
Low Expression Levels:
Solution: Optimize codon usage for expression host
Solution: Test multiple fusion tags (MBP, SUMO, Trx) to enhance solubility
Solution: Explore specialized expression hosts (C41/C43 E. coli, Pichia pastoris)
Solution: Implement auto-induction media for gentler expression
Protein Aggregation:
Solution: Lower induction temperature (16-18°C)
Solution: Add stabilizing agents (glycerol 5-10%, sucrose)
Solution: Incorporate specific lipids during extraction and purification
Solution: Test expression as truncated constructs of hydrophilic domains
Inefficient Purification:
Solution: Optimize detergent type and concentration (screen DDM, LMNG, FC-12)
Solution: Implement two-step purification (affinity followed by size exclusion)
Solution: Use on-column detergent exchange during purification
Solution: Consider nanodiscs or amphipols for stabilization post-purification
Structural Instability:
Solution: Screen buffer conditions using differential scanning fluorimetry
Solution: Add specific lipids (cardiolipin, PE) to stabilize native conformation
Solution: Develop binding partners or antibody fragments to stabilize structure
Solution: Implement chemical crosslinking to prevent dissociation
Functional Assessment Difficulties:
Solution: Develop miniaturized activity assays requiring less protein
Solution: Use sensitive fluorescence-based methods for activity detection
Solution: Implement reconstitution into proteoliposomes for functional studies
Solution: Develop pull-down assays to verify interactions with other subunits
Validating native folding and functionality of recombinant MT-ND4L requires a multi-faceted approach:
When designing comparative experiments between wild-type and mutant MT-ND4L forms, researchers should consider:
Experimental Design Principles:
Include multiple biological and technical replicates
Perform parallel purification of wild-type and mutant proteins
Implement appropriate controls (including catalytically inactive mutants)
Use statistical methods for determining appropriate sample sizes
Consider blind analysis to prevent bias
Mutation Selection Strategy:
Target highly conserved residues identified through multiple sequence alignment
Include disease-associated mutations from clinical studies
Create a panel of mutations with varying predicted severity
Include mutations in different functional domains
Design compensatory mutations to test specific hypotheses
Comparative Parameters to Measure:
Expression levels and stability in the chosen system
Purification yield and behavior during chromatography
Thermal stability using differential scanning fluorimetry
Structural integrity by CD spectroscopy or limited proteolysis
Assembly competence with other Complex I subunits
Functional activity in reconstituted systems
Interaction profile with other subunits and cofactors
Normalization and Standardization:
Normalize activity to protein concentration
Ensure identical buffer conditions for all comparisons
Standardize protocols for expression, purification, and assays
Include internal standards for quantitative comparisons
Account for batch-to-batch variation in components
Advanced Approaches:
Structural studies to directly visualize effects of mutations
Molecular dynamics simulations to predict dynamic effects
Hydrogen-deuterium exchange to map conformational changes
Deep mutational scanning for comprehensive mutational analysis
Integration of multiple data types for systems-level understanding
Mirza coquereli MT-ND4L provides a valuable model for understanding primate mitochondrial evolution through several research approaches:
Comparative Evolutionary Analysis:
Sequence comparison across lemur species, other primates, and mammals
Calculation of evolutionary rates and identification of selection patterns
Mapping of conserved versus variable regions to functional domains
Correlation of sequence variations with ecological adaptations and metabolic demands
Biogeographic and Phylogenetic Applications:
Use of MT-ND4L as part of the PAST fragment for phylogenetic reconstruction
Analysis of gene flow patterns across geographic barriers in Madagascar
Dating of divergence events in lemur evolution
Correlation of genetic divergence with geological and climatic events
Mitonuclear Coevolution Studies:
Comparison of evolutionary patterns between MT-ND4L and nuclear-encoded Complex I subunits
Identification of compensatory mutations to maintain functional interactions
Analysis of amino acid substitution patterns at interaction interfaces
Experimental testing of compatibility between mitochondrial and nuclear components
Adaptive Evolution Research:
Investigation of MT-ND4L adaptations to different ecological niches
Correlation between amino acid substitutions and metabolic requirements
Functional testing of adaptive hypotheses through recombinant protein studies
Comparative analysis with species that have undergone gene transfer events
The PAST fragment, which includes MT-ND4L, has been instrumental in taxonomic and phylogenetic studies of lemurs. In particular, studies have utilized this region to resolve relationships between closely related lemur species and to identify cryptic diversity, as exemplified in the molecular genetic analyses of sportive lemurs (genus Lepilemur) .
Investigating the structure-function relationship of MT-ND4L in proton translocation can provide several novel insights:
Proton Translocation Mechanism:
Identification of conserved charged residues involved in proton pathway formation
Characterization of conformational changes coupled to electron transfer
Elucidation of the role of MT-ND4L in maintaining proton impermeability of the membrane domain
Determination of specific residues that coordinate with quinone binding and reduction
Methodology for Mechanistic Studies:
Site-directed mutagenesis of key residues predicted to participate in proton channels
Reconstitution of MT-ND4L variants into proteoliposomes for proton pumping assays
Application of computational approaches (molecular dynamics simulations) to model proton movement
Development of specific probes to monitor conformational changes during catalytic cycle
Integration with Structural Data:
Mapping of functional residues onto high-resolution structures
Identification of water molecules and their networks in proton translocation
Characterization of lipid-protein interactions critical for proton pumping
Analysis of inter-subunit interfaces that form functional proton pathways
Energetic Coupling Models:
Investigation of how electron transfer is coupled to proton pumping
Determination of the stoichiometry of protons pumped per electron
Elucidation of the molecular basis for energy transduction
Development of models for long-range conformational coupling
Pathological Mechanisms:
Understanding how mutations in MT-ND4L disrupt proton pumping
Correlation between specific defects in proton translocation and disease phenotypes
Identification of compensatory mechanisms that maintain function despite mutations
Development of targeted therapeutic approaches to rescue defective proton pumping
Understanding MT-ND4L structure and function can significantly advance therapeutic development for mitochondrial disorders through multiple pathways:
The study of ND4L has particular therapeutic relevance as mutations in mitochondrial-encoded Complex I subunits are known to be responsible for many hereditary diseases in humans. Understanding the impact of these mutations on complex I assembly and activity is crucial for developing targeted therapeutic approaches .