Recombinant Mirza coquereli NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant MT-ND4L

Recombinant Mirza coquereli NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a synthetic version of the mitochondrial protein encoded by the MT-ND4L gene in Coquerel’s mouse lemur (Mirza coquereli). This protein is a core subunit of Complex I (NADH dehydrogenase), a critical enzyme in the mitochondrial electron transport chain (ETC) responsible for transferring electrons from NADH to ubiquinone and pumping protons across the inner mitochondrial membrane .

Key Features

  • Source: Expressed in E. coli, yeast, or mammalian cells .

  • Function: Integral to oxidative phosphorylation, enabling ATP production via proton gradient formation .

  • Clinical Relevance: While human MT-ND4L mutations are linked to Leber’s Hereditary Optic Neuropathy (LHON), the recombinant Mirza coquereli variant is primarily used in research to study mitochondrial function and disease mechanisms .

Amino Acid Sequence and Gene Overlap

The MT-ND4L gene in Mirza coquereli encodes a 98-amino acid protein (partial sequence: MPSISINITLAFTTALLGmLMFRSHMMSSLLCLEGMmLSMFILSTLIILNVQLTMSFMMP ILLLVFAACEAAIGLALLVMISNTYGLDYIQNLNLLQC) . Notably, the gene overlaps with MT-ND4 in other species, a feature conserved to optimize mitochondrial DNA packing .

Protein Properties

PropertyValue
Molecular Weight~10.7 kDa (estimated from human orthologs)
Purity>85% (SDS-PAGE)
TagDepends on expression system (e.g., His-tag, Avi-tag)
Expression SystemsE. coli, yeast, mammalian cells, baculovirus

Research Applications

  • Mitochondrial Function Studies: Investigating Complex I assembly and electron transport efficiency .

  • Disease Modeling: Exploring mitochondrial dysfunction in LHON and metabolic disorders .

  • Structural Biology: Analyzing transmembrane domain interactions via X-ray crystallography or cryo-EM .

Role in Complex I Activity

MT-ND4L is part of the minimal catalytic core of Complex I, stabilizing the transmembrane region and facilitating proton pumping . Mutations in this subunit disrupt electron transfer, impairing ATP synthesis .

Challenges in Production

  • Low Solubility: Hydrophobic transmembrane domains require specialized detergents for solubilization .

  • Post-Translational Modifications: Phosphorylation or lipidation may affect functional assays in vitro .

Comparative Analysis of Recombinant Systems

Expression SystemAdvantagesLimitations
E. coliHigh yield, cost-effectiveLimited post-translational modifications
Yeast/Mammalian CellsNative-like modifications, membrane integrationLower yield, higher cost
BaculovirusProper folding for structural studiesComplex purification

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Mirza coquereli (Coquerel's mouse lemur) (Microcebus coquereli)
Target Names
Target Protein Sequence
MPSISINITLAFTTALLGMLMFRSHMMSSLLCLEGMMLSMFILSTLIILNVQLTMSFMMP ILLLVFAACEAAIGLALLVMISNTYGLDYIQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-ubiquinone oxidoreductase chain 4L in mitochondrial function?

NADH-ubiquinone oxidoreductase chain 4L functions as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. MT-ND4L is specifically part of the enzyme membrane arm that is embedded in the lipid bilayer and is critically involved in proton translocation across the inner mitochondrial membrane . This proton translocation is essential for generating the electrochemical gradient that drives ATP synthesis, making MT-ND4L vital for cellular energy production.

How does MT-ND4L from Mirza coquereli compare structurally to that of other species?

While specific structural data on Mirza coquereli MT-ND4L is limited, comparative analysis with other mammalian species reveals that MT-ND4L is highly conserved but contains species-specific variations. For example, the mitred leaf monkey (Presbytis melalophos) MT-ND4L consists of 98 amino acids with a sequence that shows a characteristic hydrophobic profile consistent with its membrane-embedded nature . Similar NADH-ubiquinone oxidoreductase chain 4L proteins in other species such as donkey (Equus asinus) and wild yak (Bos mutus grunniens) also consist of 98 amino acids with species-specific variations in their amino acid sequences, particularly in regions not critical for function . Detailed structural comparison would require alignment of the Mirza coquereli sequence with these known sequences to identify conserved domains and species-specific variations.

What is the genomic organization of the MT-ND4L gene in Mirza coquereli?

The MT-ND4L gene in Mirza coquereli, like in most mammals, is encoded in the mitochondrial genome. Based on comparative data from other primates, the gene typically does not contain introns. In some species, the ND4L gene is positioned adjacent to or overlapping with the ND4 gene. In genomic studies of lemurs, including analysis that covered Mirza coquereli, the PAST fragment (a mitochondrial DNA region) includes the NADH-dehydrogenase subunits 3, 4L, and 4 (ND3, ND4L, and ND4), as well as the tRNAGly, tRNAArg, tRNAHis, tRNASer, and partial tRNALeu genes . This organization allows for the amplification of the complete MT-ND4L gene for phylogenetic and comparative studies, which has been crucial for taxonomic classification of lemur species.

What are the optimal conditions for expressing recombinant MT-ND4L from Mirza coquereli?

Expression of recombinant MT-ND4L presents several challenges due to its hydrophobic nature and mitochondrial origin. Recommended methodology includes:

  • Expression System Selection: For membrane proteins like MT-ND4L, specialized expression systems such as E. coli C41(DE3) or C43(DE3) strains (specifically designed for membrane proteins) may yield better results.

  • Vector Design: Including a fusion tag (His6, GST, or MBP) can improve solubility and facilitate purification. A TEV or PreScission protease cleavage site should be incorporated for tag removal.

  • Expression Conditions:

    • Induction at lower temperatures (16-20°C)

    • Extended expression times (16-24 hours)

    • Lower IPTG concentrations (0.1-0.5 mM)

    • Addition of membrane-stabilizing agents (e.g., glycerol at 5-10%)

  • Codon Optimization: Adapting the Mirza coquereli MT-ND4L sequence to the expression host's codon preference is critical for improving expression levels.

  • Detergent Selection: Initial solubilization and purification should be tested with various detergents (CHAPS, DDM, or Triton X-100) to determine optimal extraction efficiency while maintaining protein stability .

How can researchers verify the structural integrity of purified recombinant MT-ND4L?

Verification of structural integrity for recombinant MT-ND4L should employ multiple complementary techniques:

  • SDS-PAGE and Western Blotting: Initial verification of protein size and purity.

  • Circular Dichroism (CD) Spectroscopy: To assess secondary structure composition and confirm proper folding. For MT-ND4L, expect predominantly alpha-helical structure with characteristic minima at 208 and 222 nm.

  • Size Exclusion Chromatography: To evaluate oligomeric state and homogeneity.

  • Mass Spectrometry: For precise molecular weight determination and verification of post-translational modifications. Electrospray mass spectrometry has been successfully used to identify novel subunits of bovine complex I and can be adapted for verification of recombinant MT-ND4L .

  • Functional Assays: Measuring NADH:ubiquinone oxidoreductase activity in reconstituted systems or upon incorporation into membrane mimetics (liposomes or nanodiscs).

  • Thermostability Assays: Using differential scanning fluorimetry to assess protein stability and identify optimal buffer conditions.

  • Structural Analysis: Limited proteolysis to evaluate domain organization and stability .

What techniques are recommended for studying MT-ND4L interactions with other Complex I subunits?

To study MT-ND4L interactions with other Complex I subunits, the following methodologies are recommended:

  • Crosslinking Coupled with Mass Spectrometry: This approach can capture transient interactions between MT-ND4L and neighboring subunits. Use membrane-permeable crosslinkers like DSS or DSG, followed by tryptic digestion and MS/MS analysis to identify crosslinked peptides.

  • Co-immunoprecipitation (Co-IP): Using antibodies against MT-ND4L or potential interacting partners to pull down protein complexes, followed by Western blotting or mass spectrometry analysis.

  • Blue Native PAGE: For analyzing intact complex I assembly and subcomplexes containing MT-ND4L.

  • Proximity Labeling: Techniques such as BioID or APEX2 can be employed by fusing these enzymes to MT-ND4L to identify neighboring proteins in the native environment.

  • Yeast Two-Hybrid Membrane System (MYTH): Adapted for membrane proteins to detect binary interactions.

  • Surface Plasmon Resonance (SPR): For quantitative analysis of binding kinetics between purified MT-ND4L and other complex I components.

  • Reconstitution Experiments: Systematic reconstitution of complex I subunits to assess functional interdependencies and assembly requirements .

How has the MT-ND4L gene evolved across lemur species, and what can this tell us about Mirza coquereli's evolutionary history?

The evolution of MT-ND4L across lemur species provides valuable insights into Mirza coquereli's evolutionary history:

  • Phylogenetic Analysis: Studies utilizing the PAST fragment (which includes ND4L) have been instrumental in elucidating lemur phylogeny. For instance, molecular genetic analyses of sportive lemurs (genus Lepilemur) have utilized this region for taxonomic classification and phylogenetic reconstruction .

  • Nucleotide Substitution Patterns: Comparisons of MT-ND4L sequences across lemur species reveal patterns of evolutionary conservation and change. Nonsynonymous to synonymous substitution ratio (dN/dS) analysis can identify sites under positive selection, which may relate to functional adaptations.

  • Biogeographic Distribution: Mitochondrial DNA analysis, including MT-ND4L, has contributed to understanding the biogeographic distribution of lemur species across Madagascar. This includes identifying barriers to gene flow such as rivers and mountains that have shaped lemur evolution .

  • Divergence Dating: Molecular clock analyses using MT-ND4L and other mitochondrial genes help estimate divergence times between Mirza coquereli and related lemur species.

  • Conservation Implications: Understanding the genetic uniqueness of Mirza coquereli populations through MT-ND4L analysis contributes to conservation planning and prioritization.

The evolutionary analysis of MT-ND4L has particular significance because in some species of lemurs (e.g., Chlamydomonas reinhardtii), the ND4L gene has been transferred from the mitochondrial to the nuclear genome, unlike in most mammals where it remains mitochondrially encoded . This makes the gene particularly interesting for studying mitochondrial gene transfer events across evolutionary history.

What are the key functional differences between nuclear-encoded and mitochondrial-encoded ND4L proteins?

The comparison between nuclear-encoded and mitochondrial-encoded ND4L proteins reveals several key functional and structural differences:

CharacteristicMitochondrial-encoded ND4LNuclear-encoded ND4L
HydrophobicityHighly hydrophobicLower hydrophobicity to facilitate import
Signal SequencesAbsentContains mitochondrial targeting sequence
Codon UsageMitochondrial genetic codeNuclear genetic code
Post-translational ProcessingMinimalRequires processing of targeting sequence
Expression RegulationCoordinated with mitochondrial biogenesisIntegrated with nuclear gene expression programs
Evolutionary RateGenerally fasterGenerally slower

Studies of algal species like Chlamydomonas reinhardtii, where ND4L is nuclear-encoded (NUO11), demonstrate that nuclear-encoded versions typically show reduced hydrophobicity compared to mitochondrially-encoded counterparts, which facilitates protein import into mitochondria . Additionally, nuclear-encoded ND4L proteins acquire features that facilitate their expression and proper import into mitochondria.

The expression suppression of nuclear-encoded NUO3 and NUO11 genes (homologs of ND3 and ND4L) through RNA interference demonstrated that the absence of these polypeptides prevents the assembly of the entire 950-kDa complex I and eliminates enzyme activity, highlighting their essential role regardless of genomic origin .

How can researchers use MT-ND4L sequence data in molecular phylogenetic studies of lemurs?

Researchers can effectively use MT-ND4L sequence data in molecular phylogenetic studies of lemurs through the following methodological approaches:

  • Primer Design and Amplification Strategy: The PAST fragment, which includes ND4L, can be amplified using established primer sets under specific PCR conditions: 94°C for 30s, 47°C for 45s, 72°C for 45s for 34 cycles. To minimize inadvertent amplification of nuclear insertions or mitochondrial pseudogenes, researchers should amplify the mitochondrial DNA regions as intersecting or overlapping segments .

  • Multiple Sequence Alignment: After obtaining MT-ND4L sequences, researchers should use algorithms such as MUSCLE or MAFFT for accurate alignment, followed by manual refinement to ensure proper codon alignment.

  • Model Selection: Before phylogenetic analysis, determine the best-fit nucleotide substitution model using programs like MrModeltest or jModelTest to ensure accurate tree reconstruction .

  • Phylogenetic Analysis Methods:

    • Maximum Likelihood analysis using PAUP* or RAxML

    • Bayesian inference using MrBayes with Markov Chain Monte Carlo (MCMC) runs of at least 1,000,000 generations

    • Maximum Parsimony and Neighbor-Joining as complementary approaches

  • Haplotype Network Analysis: Construct minimum spanning networks of lemur haplotypes to visualize relationships between closely related sequences and identify missing intermediates .

  • Taxonomic Applications: MT-ND4L sequence data has proven valuable for identifying cryptic species and resolving taxonomic uncertainties in lemurs, as demonstrated by studies that have led to the description of new species based on genetic divergence patterns .

Researchers have successfully used this approach to understand the biogeographic distribution of lemur species across Madagascar, particularly in relation to major river systems and ecological barriers that have influenced speciation .

What are the most reliable methods for assessing MT-ND4L function in the context of Complex I activity?

Assessing MT-ND4L function within Complex I requires multiple complementary approaches:

  • Enzyme Activity Assays:

    • NADH:ubiquinone oxidoreductase activity measurement using artificial electron acceptors (decylubiquinone or coenzyme Q1)

    • Rotenone-sensitive and rotenone-insensitive activity differentiation

    • Spectrophotometric monitoring of NADH oxidation at 340 nm

    • Oxygen consumption measurements using polarography or oxygen-sensitive fluorescent probes

  • Proton Pumping Assessment:

    • pH-sensitive fluorescent dyes (ACMA, pyranine) to monitor proton translocation

    • Potentiometric measurements with pH electrodes

    • Reconstitution of purified complex I into liposomes for controlled proton gradient studies

  • Structural Integrity Analysis:

    • Blue Native PAGE to assess intact Complex I assembly

    • Western blotting to verify MT-ND4L incorporation into Complex I

    • Immunoprecipitation of Complex I followed by proteomic analysis

  • Mutagenesis Studies:

    • Site-directed mutagenesis of conserved residues in MT-ND4L

    • Functional complementation assays in knockout/knockdown systems

    • Analysis of disease-associated mutations and their biochemical consequences

  • Inhibitor Sensitivity Profiling:

    • Dose-response curves with Complex I inhibitors (rotenone, piericidin A)

    • Competition assays to identify inhibitor binding sites

    • Photoaffinity labeling to map inhibitor interaction sites

How can researchers distinguish between effects of MT-ND4L mutations on Complex I assembly versus catalytic activity?

Distinguishing between assembly and catalytic defects caused by MT-ND4L mutations requires systematic analysis:

  • Assembly Analysis:

    • Blue Native PAGE combined with Western blotting to visualize Complex I assembly intermediates

    • Immunoprecipitation of assembly factors (NDUFAF1-6) to assess interaction with mutant MT-ND4L

    • Pulse-chase experiments to track the kinetics of Complex I assembly

    • Analysis of subcomplexes accumulation patterns specific to different assembly defects

  • Activity Measurements:

    • Normalized activity assays (activity per amount of fully assembled Complex I)

    • Spectroelectrochemical analysis of electron transfer rates

    • EPR spectroscopy to assess iron-sulfur cluster incorporation and function

    • Proton pumping efficiency measurements in reconstituted systems

  • Systematic Approach to Differentiation:

    • First, quantify the amount of fully assembled Complex I

    • Then measure activity normalized to assembled complex

    • If normalized activity is maintained but total activity is reduced, the defect is primarily in assembly

    • If normalized activity is reduced, the defect affects catalytic function

    • If both are affected, the mutation impacts both processes

  • Complementation Studies:

    • Expression of wild-type MT-ND4L in mutant backgrounds

    • Analysis of rescue efficiency for assembly versus activity

    • Domain-swapping experiments to identify regions critical for either function

What bioinformatic tools and resources are most valuable for analyzing MT-ND4L sequences and predicting the impact of mutations?

For comprehensive analysis of MT-ND4L sequences and mutation effects, researchers should utilize the following bioinformatic tools and resources:

  • Sequence Analysis and Evolutionary Conservation:

    • BLAST and HMMER for sequence similarity searches

    • ConSurf for evolutionary conservation analysis

    • Clustal Omega, MUSCLE, or T-Coffee for multiple sequence alignment

    • MEGA X for phylogenetic analysis and evolutionary rate calculation

  • Structural Prediction and Analysis:

    • TMHMM, TOPCONS, or Phobius for transmembrane domain prediction

    • AlphaFold or RoseTTAFold for structure prediction

    • PyMOL or UCSF Chimera for structural visualization and analysis

    • HADDOCK or MDockPP for protein-protein docking (to predict interactions with other Complex I subunits)

  • Mutation Effect Prediction:

    • SIFT, PolyPhen-2, or PROVEAN for assessing mutation pathogenicity

    • MutPred for predicting molecular mechanisms of disease

    • SNAP2 or INPS for stability change prediction

    • MItoNuclear Coevolution Assessment (MINCA) for analyzing mitonuclear compatibility

  • Specialized Resources:

    • MitoMap for mitochondrial genome variation database

    • MitImpact for pathogenicity prediction of mitochondrial variants

    • UniProt for protein annotation and conservation data

    • KEGG for metabolic pathway integration

    • Pfam and InterPro for domain prediction and annotation

  • Integration and Visualization:

    • Cytoscape for network analysis and visualization

    • R with Bioconductor packages for statistical analysis and visualization

    • IGV or UCSC Genome Browser for genomic context visualization

How can recombinant MT-ND4L be used to study mitochondrial disease mechanisms related to Complex I deficiency?

Recombinant MT-ND4L provides powerful tools for studying Complex I-related mitochondrial diseases:

  • In Vitro Reconstitution Systems:

    • Reconstitution of wild-type and mutant MT-ND4L into liposomes or nanodiscs

    • Comparison of proton pumping efficiency and electron transfer rates

    • Assessment of ROS production by different MT-ND4L variants

    • Structure-function relationship studies to map critical residues

  • Cell-Based Models:

    • Creation of MT-ND4L knockout cell lines using mitochondria-targeted CRISPR systems

    • Complementation with wild-type or mutant recombinant MT-ND4L

    • Phenotypic rescue assays to assess functional recovery

    • Live-cell imaging to track mitochondrial dynamics and function

  • Patient-Derived Mutation Analysis:

    • Biochemical characterization of patient-specific MT-ND4L mutations

    • Development of high-throughput screens for compounds that can rescue mutant phenotypes

    • Structure-based drug design targeting MT-ND4L interaction sites

  • Biotechnological Applications:

    • Development of MT-ND4L-based biosensors for mitochondrial function

    • Creation of diagnostic tools for rapid assessment of MT-ND4L mutations

    • Design of peptide inhibitors or activators targeting specific MT-ND4L domains

  • Evolutionary Medicine Approaches:

    • Comparative analysis of MT-ND4L across species with different metabolic demands

    • Identification of compensatory mechanisms in species with naturally occurring variants

    • Insights into mitonuclear co-evolution and its implications for disease

What are the challenges and solutions for incorporating recombinant MT-ND4L into functional Complex I for structural studies?

Incorporating recombinant MT-ND4L into functional Complex I presents several challenges, with corresponding methodological solutions:

ChallengeSolution ApproachTechnical Details
HydrophobicityDetergent optimizationSystematic screening of detergents (DDM, LMNG, GDN) at various concentrations; use of amphipols or SMALPs for enhanced stability
Proper foldingMembrane mimeticsReconstitution into nanodiscs with defined lipid composition; use of lipid cubic phase for crystallization
Assembly with other subunitsStepwise reconstitutionSystematic addition of purified subunits or subcomplexes; monitoring assembly by BN-PAGE or cryo-EM
Stability of the complexChemical crosslinkingGraFix method combining glycerol gradient with mild crosslinking; site-specific crosslinking guided by structural data
Functionality verificationActivity assaysTailored assays measuring electron transfer and proton pumping in the reconstituted complex
Structural determinationCryo-EM optimizationSample homogeneity verification by negative stain EM before cryo-EM; careful screening of grid preparation conditions
Expression of multiple subunitsMulti-protein expression systemsMultiBac system for simultaneous expression of multiple Complex I subunits in insect cells
Post-translational modificationsEukaryotic expression systemsUse of mammalian or insect cell expression systems to ensure proper modifications

These methodological approaches have been successfully applied in structural studies of other membrane protein complexes and can be adapted for Complex I reconstitution with recombinant MT-ND4L .

How can nuclear-encoded versus mitochondrial-encoded ND4L homologs be used to study mitochondrial gene transfer and expression evolution?

The unique evolutionary history of ND4L, with examples of both mitochondrial and nuclear encoding across different species, provides an excellent model for studying mitochondrial gene transfer:

  • Comparative Genomic Approaches:

    • Systematic identification of species with nuclear versus mitochondrial ND4L

    • Characterization of flanking sequences to understand insertion mechanisms

    • Dating of gene transfer events through molecular clock analyses

    • Identification of intermediate stages of gene transfer across taxa

  • Expression Regulation Studies:

    • Analysis of transcriptional and translational regulation differences

    • Comparison of codon optimization between nuclear and mitochondrial versions

    • Investigation of nuclear transcription factors that regulate nuclear-encoded ND4L

    • Assessment of coordination between nuclear and mitochondrial gene expression

  • Protein Import and Processing Analysis:

    • Characterization of mitochondrial targeting sequences in nuclear-encoded ND4L

    • Comparative analysis of import efficiency across species

    • Identification of chaperones and processing peptidases involved

    • In vitro import assays comparing nuclear-encoded ND4L variants

  • Functional Evolutionary Studies:

    • Hydrophobicity comparison between nuclear and mitochondrial ND4L homologs

    • Functional complementation experiments across species

    • Measurement of Complex I assembly efficiency with nuclear versus mitochondrial ND4L

    • Analysis of mitonuclear co-evolution following gene transfer

  • Experimental Models:

    • Creation of artificial gene transfer models using Chlamydomonas reinhardtii as a reference

    • RNA interference experiments to suppress nuclear-encoded ND4L expression

    • Forced expression of mitochondrial ND4L from the nucleus with targeting sequences

    • Assessment of fitness consequences of different genetic architectures

What are the most common challenges when working with recombinant MT-ND4L and how can they be addressed?

Working with recombinant MT-ND4L presents several technical challenges that can be systematically addressed:

  • Low Expression Levels:

    • Solution: Optimize codon usage for expression host

    • Solution: Test multiple fusion tags (MBP, SUMO, Trx) to enhance solubility

    • Solution: Explore specialized expression hosts (C41/C43 E. coli, Pichia pastoris)

    • Solution: Implement auto-induction media for gentler expression

  • Protein Aggregation:

    • Solution: Lower induction temperature (16-18°C)

    • Solution: Add stabilizing agents (glycerol 5-10%, sucrose)

    • Solution: Incorporate specific lipids during extraction and purification

    • Solution: Test expression as truncated constructs of hydrophilic domains

  • Inefficient Purification:

    • Solution: Optimize detergent type and concentration (screen DDM, LMNG, FC-12)

    • Solution: Implement two-step purification (affinity followed by size exclusion)

    • Solution: Use on-column detergent exchange during purification

    • Solution: Consider nanodiscs or amphipols for stabilization post-purification

  • Structural Instability:

    • Solution: Screen buffer conditions using differential scanning fluorimetry

    • Solution: Add specific lipids (cardiolipin, PE) to stabilize native conformation

    • Solution: Develop binding partners or antibody fragments to stabilize structure

    • Solution: Implement chemical crosslinking to prevent dissociation

  • Functional Assessment Difficulties:

    • Solution: Develop miniaturized activity assays requiring less protein

    • Solution: Use sensitive fluorescence-based methods for activity detection

    • Solution: Implement reconstitution into proteoliposomes for functional studies

    • Solution: Develop pull-down assays to verify interactions with other subunits

How can researchers validate that their recombinant MT-ND4L retains native folding and functionality?

Validating native folding and functionality of recombinant MT-ND4L requires a multi-faceted approach:

What are the key considerations for designing experiments that compare wild-type and mutant forms of MT-ND4L?

When designing comparative experiments between wild-type and mutant MT-ND4L forms, researchers should consider:

  • Experimental Design Principles:

    • Include multiple biological and technical replicates

    • Perform parallel purification of wild-type and mutant proteins

    • Implement appropriate controls (including catalytically inactive mutants)

    • Use statistical methods for determining appropriate sample sizes

    • Consider blind analysis to prevent bias

  • Mutation Selection Strategy:

    • Target highly conserved residues identified through multiple sequence alignment

    • Include disease-associated mutations from clinical studies

    • Create a panel of mutations with varying predicted severity

    • Include mutations in different functional domains

    • Design compensatory mutations to test specific hypotheses

  • Comparative Parameters to Measure:

    • Expression levels and stability in the chosen system

    • Purification yield and behavior during chromatography

    • Thermal stability using differential scanning fluorimetry

    • Structural integrity by CD spectroscopy or limited proteolysis

    • Assembly competence with other Complex I subunits

    • Functional activity in reconstituted systems

    • Interaction profile with other subunits and cofactors

  • Normalization and Standardization:

    • Normalize activity to protein concentration

    • Ensure identical buffer conditions for all comparisons

    • Standardize protocols for expression, purification, and assays

    • Include internal standards for quantitative comparisons

    • Account for batch-to-batch variation in components

  • Advanced Approaches:

    • Structural studies to directly visualize effects of mutations

    • Molecular dynamics simulations to predict dynamic effects

    • Hydrogen-deuterium exchange to map conformational changes

    • Deep mutational scanning for comprehensive mutational analysis

    • Integration of multiple data types for systems-level understanding

How can Mirza coquereli MT-ND4L be used as a model for understanding primate mitochondrial evolution?

Mirza coquereli MT-ND4L provides a valuable model for understanding primate mitochondrial evolution through several research approaches:

  • Comparative Evolutionary Analysis:

    • Sequence comparison across lemur species, other primates, and mammals

    • Calculation of evolutionary rates and identification of selection patterns

    • Mapping of conserved versus variable regions to functional domains

    • Correlation of sequence variations with ecological adaptations and metabolic demands

  • Biogeographic and Phylogenetic Applications:

    • Use of MT-ND4L as part of the PAST fragment for phylogenetic reconstruction

    • Analysis of gene flow patterns across geographic barriers in Madagascar

    • Dating of divergence events in lemur evolution

    • Correlation of genetic divergence with geological and climatic events

  • Mitonuclear Coevolution Studies:

    • Comparison of evolutionary patterns between MT-ND4L and nuclear-encoded Complex I subunits

    • Identification of compensatory mutations to maintain functional interactions

    • Analysis of amino acid substitution patterns at interaction interfaces

    • Experimental testing of compatibility between mitochondrial and nuclear components

  • Adaptive Evolution Research:

    • Investigation of MT-ND4L adaptations to different ecological niches

    • Correlation between amino acid substitutions and metabolic requirements

    • Functional testing of adaptive hypotheses through recombinant protein studies

    • Comparative analysis with species that have undergone gene transfer events

The PAST fragment, which includes MT-ND4L, has been instrumental in taxonomic and phylogenetic studies of lemurs. In particular, studies have utilized this region to resolve relationships between closely related lemur species and to identify cryptic diversity, as exemplified in the molecular genetic analyses of sportive lemurs (genus Lepilemur) .

What novel insights can be gained from studying the structure-function relationship of MT-ND4L in proton translocation?

Investigating the structure-function relationship of MT-ND4L in proton translocation can provide several novel insights:

  • Proton Translocation Mechanism:

    • Identification of conserved charged residues involved in proton pathway formation

    • Characterization of conformational changes coupled to electron transfer

    • Elucidation of the role of MT-ND4L in maintaining proton impermeability of the membrane domain

    • Determination of specific residues that coordinate with quinone binding and reduction

  • Methodology for Mechanistic Studies:

    • Site-directed mutagenesis of key residues predicted to participate in proton channels

    • Reconstitution of MT-ND4L variants into proteoliposomes for proton pumping assays

    • Application of computational approaches (molecular dynamics simulations) to model proton movement

    • Development of specific probes to monitor conformational changes during catalytic cycle

  • Integration with Structural Data:

    • Mapping of functional residues onto high-resolution structures

    • Identification of water molecules and their networks in proton translocation

    • Characterization of lipid-protein interactions critical for proton pumping

    • Analysis of inter-subunit interfaces that form functional proton pathways

  • Energetic Coupling Models:

    • Investigation of how electron transfer is coupled to proton pumping

    • Determination of the stoichiometry of protons pumped per electron

    • Elucidation of the molecular basis for energy transduction

    • Development of models for long-range conformational coupling

  • Pathological Mechanisms:

    • Understanding how mutations in MT-ND4L disrupt proton pumping

    • Correlation between specific defects in proton translocation and disease phenotypes

    • Identification of compensatory mechanisms that maintain function despite mutations

    • Development of targeted therapeutic approaches to rescue defective proton pumping

How might understanding MT-ND4L structure and function contribute to developing therapeutics for mitochondrial disorders?

Understanding MT-ND4L structure and function can significantly advance therapeutic development for mitochondrial disorders through multiple pathways:

The study of ND4L has particular therapeutic relevance as mutations in mitochondrial-encoded Complex I subunits are known to be responsible for many hereditary diseases in humans. Understanding the impact of these mutations on complex I assembly and activity is crucial for developing targeted therapeutic approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.