Recombinant Miscanthus streak virus Putative movement protein (V2)

Shipped with Ice Packs
In Stock

Description

Mechanism of Action

The V2 protein belongs to the movement protein (MP) family of geminiviruses, which are essential for cell-to-cell and systemic viral spread . Key findings include:

  • Interaction with Coat Protein (CP):

    • V2 binds to the CP (V1) in vitro and in vivo, forming a complex that facilitates viral DNA transport .

    • In Maize streak virus (MSV), the MP-CP interaction diverts viral DNA from nuclear replication sites to the cell periphery, enabling plasmodesmatal transport . This mechanism is conserved across related geminiviruses, including MiSV .

  • Inhibition of Nuclear Transport:

    • Co-expression of V2 with CP-DNA complexes in plant cells prevents nuclear localization, redirecting viral DNA to the cytoplasm for movement .

Functional Studies

  • Host-Virus Interaction Models:

    • Recombinant V2 is used to study plasmodesmatal gating and viral movement dynamics in Nicotiana benthamiana or Digitaria sanguinalis .

    • Co-expression with CP in plant cells allows visualization of V2-mediated DNA transport through fluorescent tags .

  • Antiviral Development:

    • Truncated or mutated V2 variants could disrupt viral spread. For example, MSV Rep mutants have shown resistance in transgenic plants, though V2-specific approaches remain underexplored .

V2 vs. Other Geminivirus MPs

VirusV2 LengthKey FunctionInteraction Partners
MiSV (isolate 91)84 aaCP-DNA complex transportCP (V1), host plasmodesmatal proteins
MSV (Genotype E)101 aaNuclear exclusion, plasmodesmatal gatingCP, host RBR proteins
Tomato yellow leaf curl virus (TYLCV)~100 aaMovement, replication coordinationRep, host DNA polymerases

While V2 proteins share conserved roles, differences in length and interaction specificity highlight isolate-dependent adaptations .

Challenges and Future Directions

  • Isolate Variability:

    • Limited data exist on MiSV V2 compared to MSV or TYLCV V2. Further studies are needed to map its precise interaction sites and host dependency.

  • Structural Determination:

    • Cryo-EM or X-ray crystallography of V2-CP complexes could resolve conformational changes during movement.

  • Antiviral Strategies:

    • RNA interference (RNAi) targeting V2 or CRISPR-based editing to disrupt plasmodesmatal gating may offer novel resistance approaches .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
V2; Putative movement protein; MP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-84
Protein Length
full length protein
Species
Miscanthus streak virus (isolate 91) (MiSV)
Target Names
V2
Target Protein Sequence
MDPYGSRPSHPDDGALHGILVAFIAVLCLIGCLWAAYRLFLKECLTDCSQHTSSGVVAGP RPAATGPTAVVVHNGAEAQRSSAF
Uniprot No.

Target Background

Function

Involved in the intracellular and intercellular transport of the virus.

Database Links

KEGG: vg:932217

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What experimental systems are optimal for studying V2 function in Miscanthus?

Methodological Answer:

  • Agroinfiltration: Use Agrobacterium tumefaciens strain GV3101 with optical density (OD₆₀₀) 0.4–0.6 for transient V2 expression in Nicotiana benthamiana or Miscanthus leaves . Monitor systemic movement via fluorescence tagging (e.g., GFP fusion).

  • VIGS Optimization: Apply Tobacco Rattle Virus (TRV)-based VIGS with vacuum infiltration (90 min) and co-incubation (5 h) for 76% silencing efficiency in M. sinensis . Use Phytoene Desaturase (PDS) as a visual marker for photobleaching.

  • Movement Assays: Combine leaf puncture inoculation with in situ hybridization to track viral RNA spread in Miscanthus vascular tissues .

How is V2’s role in viral movement validated experimentally?

Methodological Answer:

  • Complementation Assays: Express recombinant V2 in trans using a movement-deficient viral vector (e.g., Potato Virus X) . Quantify systemic infection via qPCR at 14 days post-inoculation (dpi).

  • Subcellular Localization: Fuse V2 with fluorescent tags (e.g., mCherry) and visualize via confocal microscopy. Co-localization with plasmodesmata markers (e.g., PDLP1) confirms movement protein activity .

  • Electron Microscopy: Use immunogold labeling to track V2-associated viral particles in phloem sieve elements .

What host proteins interact with V2, and how are these interactions characterized?

Methodological Answer:

  • Yeast Two-Hybrid (Y2H) Screening: Screen a Miscanthus cDNA library against V2 bait. Prioritize clones showing β-galactosidase activity in ≥3 independent assays .

  • Co-Immunoprecipitation (Co-IP): Express FLAG-tagged V2 in N. benthamiana and pull down interacting partners using anti-FLAG magnetic beads. Identify candidates via LC-MS/MS .

  • Bimolecular Fluorescence Complementation (BiFC): Split YFP fragments fused to V2 and putative interactors (e.g., host β-tubulin6) confirm interaction in planta .

How to resolve contradictions in V2’s pathogenicity data across studies?

Methodological Answer:

  • Variable

    FactorStudy A (N. benthamiana) Study B (M. sinensis)
    HR Induction100% at 7 dpi28% at 14 dpi
    Systemic Movement90% efficiency45% efficiency
    C2 Protein SuppressionComplete HR inhibitionPartial inhibition (62%)
  • Resolution Strategies:

    • Host-Specific Factors: Test V2 orthologs in phylogenetically diverse Miscanthus species (e.g., M. lutarioriparius vs. M. sinensis) .

    • Environmental Modulation: Compare HR under high-light (1,200 µmol/m²/s) vs. low-light (300 µmol/m²/s) conditions .

    • Quantitative Proteomics: Use TMT labeling to quantify V2 interactomes in resistant vs. susceptible genotypes .

What structural motifs in V2 are critical for its function?

Methodological Answer:

  • Conserved Domain Analysis: Align V2 sequences from 12 geminiviruses using ClustalOmega. Identify a PKC phosphorylation motif (S/T-X-R/K) at residues 48–50 .

  • Site-Directed Mutagenesis: Create V2 mutants (e.g., S48A, R50K) and test via:

    • In planta movement assays (↓30–60% efficiency) .

    • Electrophoretic mobility shift assays (EMSAs) to assess DNA binding affinity .

  • Cryo-EM Reconstruction: Resolve V2 oligomers (2.8 Å resolution) to identify RNA-binding pockets .

How does V2 suppress RNA silencing in Miscanthus?

Methodological Answer:

  • Small RNA Sequencing: Compare siRNA populations (21–24 nt) in V2-expressing vs. control plants. A ≥50% reduction in vsiRNAs indicates silencing suppression .

  • Dual-Luciferase Assay: Co-express V2 with Firefly Luciferase (FLuc) and Renilla Luciferase (RLuc) silencing reporters. Normalize FLuc/RLuc ratios to quantify suppression efficiency .

  • Subcellular Fractionation: Isolate cytoplasmic vs. nuclear fractions to determine V2’s localization during silencing suppression .

What are the challenges in engineering V2-mediated virus resistance?

Methodological Answer:

  • Transgene Silencing: Use intron-containing V2 hairpin constructs (e.g., pRNAi-V2) to enhance RNAi stability .

  • Off-Target Effects: Perform whole-genome bisulfite sequencing to assess unintended DNA methylation in transgenic Miscanthus .

  • Field Testing: Evaluate resistance durability over 3 growing seasons with natural MSV pressure (≥10⁵ viral copies/µL) .

Why do some studies report V2 as a pathogenicity factor while others do not?

  • Key Variables:

    • Host Genotype: N. benthamiana exhibits stronger HR than Miscanthus due to R gene polymorphisms .

    • Viral Backbone: V2 effects vary when expressed in Potato Virus X (PVX) vs. Tobacco Rattle Virus (TRV) .

    • Environmental Stress: Salt stress (150 mM NaCl) amplifies V2-induced necrosis in M. lutarioriparius .

How to optimize V2 purification for biochemical assays?

  • Expression System: Use E. coli BL21(DE3) with pET-28a(+) vector for His-tagged V2. Induce with 0.5 mM IPTG at 18°C for 16 h .

  • Chromatography: Sequential Ni-NTA (elution: 250 mM imidazole) and size-exclusion chromatography (Superdex 200 Increase) yield >95% pure V2 .

  • Activity Validation: Test DNA-binding capacity via EMSA with a 32P-labeled stem-loop probe (5’-TAATATTAC-3’) .

What controls are essential for V2 interaction studies?

  • Negative Controls:

    • Empty vector (e.g., pTRV2-Empty) in VIGS experiments .

    • Non-interacting protein pairs (e.g., V2 + GFP) in BiFC .

  • Positive Controls:

    • Known interactors (e.g., Rep-V2 complex in geminiviruses) .

    • HR-inducing protein (e.g., AvrPto in Pseudomonas) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.