Recombinant Mitochondrial fission process protein 1 (mtp-18)

What is MTP18 and what are its cellular localization patterns?

MTP18, also known as Mitochondrial Fission Process Protein 1 (MTFP1), is a nuclear-encoded mitochondrial inner membrane protein with a molecular weight of approximately 18 kDa . It is essential for maintaining mitochondrial morphology through regulation of mitochondrial fission . MTP18 is specifically localized to the inner mitochondrial membrane, making it distinct from other fission proteins that typically associate with the outer mitochondrial membrane . The protein contains 166 amino acids (in humans) with the sequence MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS . MTP18 is encoded by a nuclear PI-3 kinase dependent target gene (GenBank accession number AAH46132) .

How does MTP18 contribute to mitochondrial dynamics?

MTP18 functions as an essential intramitochondrial component of the mitochondrial division apparatus . Experimental evidence shows that MTP18 expression levels directly impact mitochondrial morphology:

• Overexpression effects: When MTP18 is overexpressed, mitochondrial morphology changes from filamentous to punctate structures, suggesting excessive mitochondrial fission . This fragmentation can be blocked when cells co-express either the mitochondrial fusion protein Mfn1 or Drp1K38A (a dominant negative version of the fission protein Drp1) .

• Knockdown effects: Conversely, loss-of-function of endogenous MTP18 through RNA interference results in highly fused mitochondria . Analysis of mitochondria within axons of cultured retinal ganglion cells (RGCs) revealed that mitochondrial size increased with MTP18 knockdown, compared to controls .

MTP18 appears to be required for mitochondrial fission because the process is blocked after overexpression of hFis1 in cells with RNAi-mediated MTP18 knockdown .

What techniques can researchers use to study MTP18 expression in tissue samples?

Researchers can employ several methods to evaluate MTP18 expression in tissue samples:

• qRT-PCR: Used to measure MTP18 mRNA levels. This technique was successfully applied to analyze expression in 20 paired tumor and peritumor tissues in hepatocellular carcinoma (HCC) studies .

• Western blot analysis: Using antibodies against MTP18 (such as Abcam ab198217) to detect protein expression levels . This method can be used alongside mitochondrial markers like Complex IV subunit I (MTCO1) to confirm mitochondrial localization.

• Immunohistochemistry: For tissue-specific localization and expression patterns.

When analyzing expression data, standardization is critical:

• Loading normalization and band quantification can be conducted using the ImageJ gel analyzer tool

• Expressing results as fold change relative to control samples provides meaningful comparisons

How can researchers effectively modulate MTP18 expression for functional studies?

Multiple approaches have proven effective for modulating MTP18 expression:

Knockdown strategies:

• MTP18-shRNA delivered via lentiviral or AAV vectors has achieved approximately 90% reduction in mRNA levels in retinal ganglion cells

• siRNA targeting MTP18 has been used successfully in multiple cell types

Overexpression methods:

• Lentiviral or AAV-mediated expression can increase MTP18 levels by over 2000% compared to controls

• Plasmid-based expression systems using MTP18 cDNA in appropriate vectors

Dual manipulation strategies:
For mitochondrial visualization during MTP18 expression manipulation, researchers have used:

• AAV-2 vectors that both modulate MTP18 expression and simultaneously label mitochondria with fluorescent proteins like mTurquoise

• These vectors demonstrate effective knockdown (reducing protein levels by approximately 75%) or expression (increasing levels by 250%) as compared to controls

What is known about MTP18's role in cancer progression?

MTP18 appears to play significant yet contrasting roles in different cancer types:

In Hepatocellular Carcinoma (HCC):

• MTP18 is commonly overexpressed in HCC tissues, mainly due to the downregulation of miR-125b

• This overexpression significantly contributes to poor prognosis of HCC patients

• Functional experiments revealed that MTP18 promotes both the growth and metastasis of HCC cells through multiple mechanisms:

  • Inducing cell cycle progression

  • Promoting epithelial to mesenchymal transition (EMT)

  • Increasing production of MMP-9

  • Suppressing apoptosis

In Oral Cancer:

• MTP18 functions as a mitophagy receptor, providing a survival advantage to oral cancer cells exposed to cellular stress

• Inhibition of MTP18-dependent mitophagy induced cell death in oral cancer cells

• MTP18 interacts with members of the LC3 family through its LC3-interacting region (LIR) to induce mitochondrial autophagy

The dual role of MTP18 in promoting cancer progression suggests it could be a novel therapeutic target, particularly through inhibition of MTP18-dependent mitophagy .

How does MTP18 integrate with mitochondrial fission machinery?

MTP18 operates within a complex network of mitochondrial fission proteins:

• Interaction with DRP1: Protein interaction analysis revealed that DRP1 (dynamin-related protein 1) exhibits the highest confidence score (0.742) to interact with MTP18 . This interaction is functionally significant, as:

  • MTP18-mediated mitochondrial fission and apoptosis is dependent on DRP1

  • When DRP1 was knocked down in the presence of MTP18 overexpression, there was a significant reduction in cells undergoing mitochondrial fission and apoptosis

  • MTP18 could not exert its pro-mitochondrial fission and pro-apoptotic effect when DRP1 is poorly expressed

• Relationship with ER and actin cytoskeleton: Recent research indicates that mitochondrial fission involves coordinated action of the endoplasmic reticulum (ER) and actin cytoskeleton . These structures help identify and mark sites for mitochondrial division, with mtDNA replication specifically associated at mitochondria–ER contacts and constrictions .

• Integration with fusion machinery: Mitochondrial fragmentation caused by MTP18 overexpression can be blocked in cells coexpressing the mitochondrial fusion protein Mfn1, indicating dynamic interplay between fission and fusion processes .

What is the significance of MTP18's role as a mitophagy receptor?

Recent research has revealed that MTP18 functions as a novel mitophagy receptor, targeting dysfunctional mitochondria into autophagosomes for elimination . This discovery adds significant depth to our understanding of MTP18's cellular functions:

• Mechanism of mitophagy induction:

  • MTP18 interacts with members of the LC3 family through its LC3-interacting region (LIR)

  • Mutation in the LIR motif (mLIR) inhibits this interaction, thus suppressing mitophagy

• Dependence on Parkin/PINK1 pathway:

  • Parkin or PINK1 deficiency abrogated mitophagy in MTP18-overexpressing human oral cancer-derived FaDu cells

  • Upon exposure to the mitochondrial oxidative phosphorylation uncoupler CCCP, MTP18[mLIR]-FaDu cells showed decreased TOM20 levels without affecting COX IV levels

  • Loss of Parkin or PINK1 resulted in inhibition of TOM20 and COX IV degradation in MTP18[mLIR]-FaDu cells exposed to CCCP

• Functional significance:

  • Parkin-mediated proteasomal degradation of outer mitochondrial membrane appears essential for effective mitophagy

  • MTP18 provides a survival advantage to cancer cells exposed to cellular stress

  • Inhibition of MTP18-dependent mitophagy induced cell death in oral cancer cells

These findings suggest that inhibition of MTP18-mitophagy could represent a promising cancer therapy strategy, particularly for oral cancers .

How does MTP18 contribute to apoptotic regulation in cardiac tissues?

MTP18 plays a specific role in cardiac apoptosis, particularly under oxidative stress conditions:

• Response to oxidative stress:

  • MTP18 was shown to be downregulated upon doxorubicin (DOX) exposure in gastric cancer cells

  • In cardiomyocytes, MTP18 regulates oxidative stress-mediated mitochondrial fission and apoptosis

• Mechanism of action in cardiac cells:

  • MTP18 induces mitochondrial fission and apoptosis by enhancing dynamin-related protein 1 (Drp1) accumulation

  • Knockdown of MTP18 interfered with Drp1-associated mitochondrial fission and subsequent activation of apoptosis in both HL-1 cells and primary cardiomyocytes

  • Overexpression of MTP18 alone was not sufficient to execute apoptosis when Drp1 was minimally expressed, suggesting that MTP18 and Drp1 are interdependent in the apoptotic cascade

• Therapeutic implications:

  • Understanding MTP18's role in cardiac apoptosis provides novel therapeutic insights for minimizing cardiomyocyte loss via targeting mitochondrial dynamics

  • This is particularly relevant for cardiac stress conditions such as coronary artery disease, aging-related cardiovascular abnormalities, and exposure to cardiac stressors like hydrogen peroxide (H₂O₂)

What are the emerging techniques for studying MTP18 interactions with mitochondrial dynamics machinery?

Several cutting-edge techniques can enhance research into MTP18's interactions:

• Proximity-based protein interaction assays:

  • BioID or APEX2 proximity labeling to identify proteins in close proximity to MTP18 in living cells

  • These techniques can reveal transient or weak interactions within the mitochondrial fission-fusion machinery

• Advanced imaging approaches:

  • Super-resolution microscopy to visualize MTP18 localization at sub-mitochondrial resolution

  • Live-cell imaging combined with photoactivatable fluorescent proteins to track dynamic changes in MTP18 localization during fission events

  • Transmission electron microscopy (TEM) has been successfully used to analyze mitochondria size and morphology in MTP18-manipulated cells

• Structural biology approaches:

  • Cryo-EM to determine the structure of MTP18 within the mitochondrial membrane

  • Molecular dynamics simulations to model MTP18 interactions with other fission proteins

• In vivo models:

  • AAV-2 vectors have been used to modulate MTP18 expression and simultaneously label mitochondria with fluorescent proteins in retinal ganglion cells in vivo

  • These approaches allow for visualization of mitochondrial dynamics in intact tissues