Recombinant Mitochondrial inner membrane organizing system protein F54A3.5 (F54A3.5)

Shipped with Ice Packs
In Stock

Description

Product Overview: Recombinant Mitochondrial Inner Membrane Organizing System Protein F54A3.5

F54A3.5 is a recombinant protein derived from Caenorhabditis elegans, expressed in E. coli and tagged with a His-tag for purification purposes. It represents the full-length mitochondrial inner membrane organizing system (MINOS) protein, spanning amino acids 1–105 (UniProt ID: Q9N4K0).

ParameterSpecification
SourceE. coli
Host OrganismCaenorhabditis elegans
TagN-terminal His-tag
Protein LengthFull-length (1–105 amino acids)
Product CodeRFL30761CF
ApplicationsResearch studies on mitochondrial membrane organization

This recombinant protein is commercially available for use in biochemical assays, structural studies, or functional analyses of MINOS complex dynamics .

Research Applications

  • Structural biology: Studying MINOS complex assembly and interactions.

  • Functional assays: Investigating mitochondrial membrane dynamics under stress (e.g., UPRmt activation) .

  • Therapeutic development: Exploring targets for mitochondrial diseases linked to inner membrane dysfunction.

Limitations

  • Lack of pathway data: No explicit pathways or interacting partners are documented for F54A3.5 in available sources .

  • Species specificity: Functional insights from yeast or mammalian MINOS studies may not directly translate to C. elegans models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
F54A3.5; MICOS complex subunit Mic10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
F54A3.5
Target Protein Sequence
MAPGASAPAASRSEDEVGQKIDRCFADSLLKVTGGVAIGIVASVAFFKSRSWPIWFGSGV GLGTGWSNCRHDFASPYVLHGKRVPAGQDSQGKPAYNIITEQHKQ
Uniprot No.

Target Background

Function
F54A3.5 is a component of the MICOS complex, a large protein complex found in the mitochondrial inner membrane. MICOS plays essential roles in maintaining crista junctions, preserving inner membrane architecture, and forming contact sites with the outer membrane.
Database Links

KEGG: cel:CELE_F54A3.5

UniGene: Cel.20553

Protein Families
MICOS complex subunit Mic10 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the function of Mitochondrial Inner Membrane Organizing System Protein F54A3.5?

F54A3.5 is a component of the mitochondrial inner membrane organizing system that helps maintain the structural integrity of cristae junctions. These junctions separate cristae from the inner boundary membrane and are crucial for maintaining proper mitochondrial function. The protein likely participates in transmembrane protein complexes that bind head-to-head and link opposing crista membranes in a bottleneck-like fashion, similar to other cristae junction proteins such as IMMT . To determine its precise function, researchers should consider complementation studies with known cristae junction proteins and observe mitochondrial ultrastructure using electron microscopy after gene knockdown or knockout.

How is F54A3.5 expression regulated in different tissues and under various cellular stresses?

While specific data on F54A3.5 regulation is not directly available in the provided materials, expression patterns typically correlate with mitochondrial activity. Tissues with higher energy demands, such as muscle cells, contain mitochondria with more cristae , suggesting potentially higher expression of cristae junction proteins in these tissues. Research approaches should include qRT-PCR analysis across tissue types, western blotting under normal versus stress conditions (oxidative stress, nutrient deprivation), and promoter analysis to identify regulatory elements.

What are the best expression systems for producing recombinant F54A3.5 for structural studies?

  • Consider using insect cell systems (Sf9, Hi5) or mammalian cells (HEK293, CHO) which better support membrane protein folding

  • Add purification tags (His, FLAG, Strep-II) that can be later cleaved by specific proteases

  • Optimize detergents for membrane protein extraction and purification

  • Follow NIH Guidelines for recombinant DNA research, particularly regarding containment levels appropriate for your expression system

For large-scale production, researchers should implement Biosafety Level 1 or 2 practices depending on the expression system, with consideration for appropriate physical containment levels as outlined in Appendix K of the NIH Guidelines .

What protocol modifications are necessary when purifying F54A3.5 compared to soluble proteins?

Purifying recombinant F54A3.5 requires specific adaptations compared to soluble proteins:

StageStandard ProtocolModified Protocol for F54A3.5
Cell LysisStandard detergent or mechanical disruptionGentle disruption with specialized detergents (DDM, LDAO, or digitonin)
Column SelectionStandard ion exchange, size exclusionDetergent-compatible columns, potential use of lipid nanodiscs
Buffer CompositionAqueous buffersDetergent-containing buffers throughout purification
Stability AssessmentThermal shift assaysModified thermal shift assays with membrane mimetics
StorageStandard glycerol stocksDetergent micelles or reconstituted proteoliposomes

Researchers should monitor protein quality using dynamic light scattering and circular dichroism to ensure proper folding throughout the purification process. When handling recombinant materials, follow appropriate biosafety guidelines based on the risk assessment of your specific construct and expression system .

How can I accurately assess F54A3.5 integration into the mitochondrial inner membrane?

To assess F54A3.5 integration into the mitochondrial inner membrane, employ multiple complementary approaches:

  • Subcellular fractionation and western blotting: Isolate mitochondria, then separate outer and inner membranes using digitonin treatment and density gradient centrifugation. Compare F54A3.5 distribution with known marker proteins for each compartment.

  • Protease protection assays: Treat isolated mitochondria with proteases with/without membrane permeabilization to determine protein topology.

  • Fluorescence microscopy: Create fluorescent protein fusions and co-localize with mitochondrial markers; consider super-resolution techniques for detailed localization at cristae junctions.

  • Electron microscopy with immunogold labeling: Use antibodies against F54A3.5 coupled with gold nanoparticles to precisely localize the protein within the cristae junctions.

Appropriate containment practices should be implemented based on the risk group of your experimental system, following NIH Guidelines for recombinant DNA molecule research .

How do I differentiate between direct effects of F54A3.5 mutation and secondary consequences of disturbed cristae architecture?

Distinguishing direct from indirect effects of F54A3.5 manipulation presents a significant challenge. To address this methodologically:

  • Temporal analysis: Use inducible expression systems to track immediate versus delayed effects following F54A3.5 depletion or overexpression.

  • Structure-function correlations: Create a panel of point mutations targeting different domains of F54A3.5 to identify which specific regions correlate with particular phenotypes.

  • Interaction partner analysis: Perform proximity labeling (BioID, APEX) to identify direct interaction partners before gross morphological changes occur.

  • Rescue experiments: Test whether wild-type F54A3.5 or specific mutants can rescue phenotypes when expressed in knockout cells.

  • Cross-comparison: Compare phenotypes with those resulting from manipulation of other cristae junction proteins like IMMT, which is known to significantly impact inner membrane structures when deleted .

These approaches help establish causality between F54A3.5 function and observed phenotypes in a way that simple knockout studies cannot.

What are the key controls needed when studying F54A3.5 involvement in mitochondrial respiratory efficiency?

When investigating F54A3.5's role in respiratory efficiency, implement these essential controls:

Control TypePurposeImplementation
Genetic ControlsVerify specificity of effectsInclude F54A3.5 knockout, knockdown, rescue lines, and alternative cristae junction protein manipulations
Biochemical ControlsRule out artifactsMeasure multiple parameters (oxygen consumption, membrane potential, ATP production) using different methodologies
Pharmacological ControlsDistinguish pathway effectsUse specific inhibitors of respiratory complexes to pinpoint where defects occur
Temporal ControlsSeparate primary from secondary effectsMonitor changes at multiple time points after F54A3.5 manipulation

Additionally, researchers should measure potential compensatory expression of other cristae junction proteins, as deletion of junction proteins like IMMT is known to significantly impact membrane potential and growth . This comprehensive control strategy helps ensure that observed respiratory defects are specifically attributable to F54A3.5 function.

How should contradictory results between in vitro and in vivo studies of F54A3.5 function be reconciled?

When facing contradictory results between in vitro and in vivo F54A3.5 studies, implement this systematic reconciliation approach:

  • Assess system complexity differences: In vitro systems lack the complete protein interaction network present in vivo. Map interaction partners in both systems using co-immunoprecipitation or proximity labeling.

  • Examine concentration effects: Protein concentrations in vitro often differ from physiological levels. Perform dose-response experiments to identify potential threshold effects.

  • Validate protein conformations: Proteins may adopt different conformations in different environments. Use limited proteolysis or hydrogen-deuterium exchange mass spectrometry to compare protein conformations.

  • Consider post-translational modifications: Check whether F54A3.5 undergoes modifications in vivo that are absent in vitro using mass spectrometry.

  • Recreate membrane environment: Reconstitute F54A3.5 in lipid compositions that better mimic the inner mitochondrial membrane, which has a lipid composition similar to bacterial membranes .

This methodological framework helps bridge the gap between simplified in vitro systems and the complex in vivo environment.

How can F54A3.5 be used to study the relationship between cristae architecture and mitochondrial function in neurodegenerative diseases?

F54A3.5 manipulation offers a valuable tool for investigating mitochondrial dysfunction in neurodegeneration through these methodological approaches:

  • Disease model integration: Introduce F54A3.5 mutations or expression changes in cellular or animal models of neurodegenerative diseases to assess how cristae junction disruption interacts with disease pathology.

  • Patient-derived cell studies: Compare F54A3.5 expression and localization in patient-derived cells versus controls, particularly in diseases with known mitochondrial involvement.

  • Structural-functional correlations: Use correlative light and electron microscopy (CLEM) to simultaneously visualize cristae architecture and functional readouts like membrane potential in disease models with F54A3.5 manipulation.

  • Therapeutic intervention testing: Test whether preserving F54A3.5 function through overexpression or stabilization can mitigate mitochondrial defects in disease models.

When conducting such studies, researchers must implement appropriate biosafety measures, particularly when working with recombinant DNA in human cellular systems, adhering to the containment practices outlined in the NIH Guidelines .

What CRISPR-Cas9 strategies are most effective for studying F54A3.5 function while minimizing off-target effects?

When designing CRISPR-Cas9 approaches for F54A3.5 functional studies, implement these strategies to maximize specificity:

  • Guide RNA design optimization:

    • Use multiple prediction algorithms to select guides with minimal predicted off-targets

    • Target critical functional domains identified through structural analysis

    • Implement paired nickase approaches for increased specificity

  • Delivery method selection:

    • For transient studies: use ribonucleoprotein (RNP) complexes rather than plasmid-based expression

    • For stable modifications: consider inducible Cas9 systems to minimize exposure time

  • Validation protocols:

    • Sequence verification of the target site

    • Off-target analysis through whole-genome sequencing or targeted sequencing of predicted off-target sites

    • Phenotypic rescue through wild-type F54A3.5 expression

  • Control integration:

    • Include non-targeting guide controls

    • Create multiple independent clones using different guide RNAs

    • Generate heterozygous variants alongside homozygous knockouts

When implementing CRISPR-Cas9 modifications, ensure compliance with the NIH Guidelines for research involving recombinant or synthetic nucleic acid molecules, including appropriate Institutional Biosafety Committee approvals .

How can super-resolution microscopy be optimized for studying F54A3.5 localization within cristae junctions?

Optimizing super-resolution microscopy for F54A3.5 localization at cristae junctions requires addressing several technical challenges:

  • Labeling strategy selection:

    • Site-specific fusion tags (SNAP, Halo, or small epitope tags) placed in non-functional regions

    • Knock-in fluorescent proteins at endogenous loci using CRISPR-Cas9

    • Validated antibodies with minimal epitope size for STORM/PALM approaches

  • Technique optimization:

    • STED microscopy: Use far-red dyes to minimize photodamage to mitochondria

    • STORM/PALM: Optimize buffer conditions for mitochondrial imaging

    • SIM: Implement 3D-SIM for better axial resolution of cristae structure

  • Sample preparation protocols:

    • Mitochondrial isolation and immobilization techniques

    • Variable fixation protocols optimized for membrane preservation

    • Correlative approaches combining live-cell pre-imaging with super-resolution

  • Data analysis approaches:

    • Implement cluster analysis algorithms to identify cristae junction distribution patterns

    • Use multi-color approaches to correlate F54A3.5 with other known cristae junction proteins

    • Quantify distances between F54A3.5 clusters and other mitochondrial substructures

These methodologies should be implemented while following appropriate biosafety levels for recombinant protein research as outlined in the NIH Guidelines, particularly when using viral vectors for protein expression .

What biosafety considerations apply when working with recombinant F54A3.5 in different experimental systems?

When working with recombinant F54A3.5, biosafety considerations vary based on the experimental system:

  • For bacterial expression systems (E. coli K-12):

    • Generally considered Biosafety Level 1 (BL1)

    • Follow the NIH Guidelines for Exempt Experiments if the construct meets criteria in Section III-F

    • Implement Good Large Scale Practice (GLSP) for production volumes >10 liters

  • For mammalian cell expression:

    • Typically Biosafety Level 2 (BL2) when using viral vectors for transfection

    • Review Section III-D-1 through III-D-3 of the NIH Guidelines for specific containment requirements

    • Obtain Institutional Biosafety Committee (IBC) approval before initiation

  • For in vivo animal studies:

    • Follow Appendix M of the NIH Guidelines for animal containment protocols

    • Implement animal facility practices that match the biosafety level required for the recombinant system

Researchers must conduct a comprehensive risk assessment (Section II-A-3) that considers the characteristics of the F54A3.5 protein, the expression system, and the experimental procedures .

What documentation and approvals are required before beginning recombinant F54A3.5 research?

Before initiating research with recombinant F54A3.5, researchers must secure the following documentation and approvals:

  • Institutional Biosafety Committee (IBC) approval:

    • Submit detailed research protocol describing:

      • The recombinant construct design

      • Expression systems to be used

      • Containment facilities and procedures

      • Risk assessment results

    • Obtain approval before beginning experiments covered under Sections III-A through III-D of the NIH Guidelines

  • Laboratory safety documentation:

    • Standard Operating Procedures (SOPs) for handling recombinant materials

    • Training records for all personnel

    • Chemical hygiene plan modifications if needed

  • Material transfer agreements (if applicable):

    • Documentation for receiving or sharing recombinant materials with other institutions

    • Verification that recipient facilities meet appropriate containment requirements

Experiments involving recombinant nucleic acids in volumes exceeding 10 liters require specific notification and potential additional approvals as outlined in Section III-D-6 of the NIH Guidelines .

How can issues with F54A3.5 aggregation during purification be resolved?

F54A3.5 aggregation during purification can be addressed through these methodological interventions:

Problem StageIntervention StrategyImplementation Details
ExpressionReduce expression rateLower induction temperature (16-18°C), use weaker promoters, or decrease inducer concentration
ExtractionOptimize detergent selectionTest panel of detergents (DDM, LMNG, GDN) at various concentrations; consider mixed micelle approaches
PurificationBuffer optimizationAdd stabilizing agents (glycerol 10-20%, specific lipids, cholesterol hemisuccinate)
SolubilityAlternative solubilization strategiesTest membrane scaffold proteins, nanodiscs, or amphipols to maintain native-like environment
StoragePrevent concentration-dependent aggregationStore at moderate concentrations (1-3 mg/ml) with cryoprotectants; avoid freeze-thaw cycles

When implementing these strategies, researchers should maintain appropriate containment practices based on the expression system being used, particularly when scaling up production, as specified in Appendix K of the NIH Guidelines .

What are the most common pitfalls when attempting to reconstitute F54A3.5 function in proteoliposomes?

When reconstituting F54A3.5 in proteoliposomes, researchers should address these common pitfalls:

  • Inappropriate lipid composition:

    • Solution: Match the lipid composition to the inner mitochondrial membrane, which resembles bacterial membranes

    • Methodology: Test various compositions including cardiolipin, which is enriched in the inner mitochondrial membrane

  • Incorrect protein orientation:

    • Solution: Use techniques to assess protein orientation after reconstitution

    • Methodology: Implement protease protection assays, membrane-impermeant labeling reagents, or orientation-specific antibodies

  • Inadequate protein-to-lipid ratio:

    • Solution: Optimize protein-to-lipid ratios through systematic testing

    • Methodology: Test ratios ranging from 1:50 to 1:2000 (w/w) to find optimal functional reconstitution

  • Loss of interaction partners:

    • Solution: Co-reconstitute F54A3.5 with known binding partners

    • Methodology: Identify interaction partners through pull-down experiments and include key partners in reconstitution

When conducting these experiments, researchers should implement appropriate biosafety measures according to the NIH Guidelines based on the source and nature of the recombinant protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.