Recombinant Mitoferrin (CBG02884)

Shipped with Ice Packs
In Stock

Description

Applications in Research

Recombinant mitoferrin proteins are widely used in:

  1. Protein Interaction Studies:

    • Identifying binding partners (e.g., ABCB10, ferrochelatase) to elucidate iron trafficking pathways .

    • Analyzing post-translational modifications (e.g., ubiquitination, phosphorylation) .

  2. Functional Assays:

    • Western Blotting (WB): Quantifying mitoferrin expression levels in cancer cells or disease models .

    • Immunoprecipitation (IP): Studying protein complexes involved in mitochondrial iron homeostasis .

  3. Therapeutic Development:

    • Testing inhibitors of mitoferrin-mediated iron uptake to enhance photodynamic therapy (PDT) efficacy in cancers .

Role in Cancer Progression

  • Glioblastoma (GBM): Overexpression of MFRN1 correlates with poor survival, promoting tumor proliferation and resistance to oxidative damage via glutathione upregulation .

  • Iron-Dependent Therapies: Mitoferrin-2 knockdown sensitizes head and neck cancer cells to PDT by disrupting mitochondrial Fe²⁺ uptake .

Iron Homeostasis and Disease

  • Mitochondrial Dysfunction: Loss of mitoferrin-1 in hepatocytes reduces oxidative phosphorylation (OXPHOS) protein levels, highlighting its role in maintaining iron balance .

  • Aging and Lifespan: C. elegans models show that mitoferrin knockdown extends lifespan by 50–80%, though mechanisms remain unclear .

Therapeutic Implications

  • Targeting Mitoferrins: Inhibiting MFRN1 in GBM may restore therapeutic sensitivity by depleting mitochondrial iron and reducing ROS production .

  • PDT Synergy: Combining PDT with lysosomal iron release (e.g., via bafilomycin) enhances cytotoxicity in mitoferrin-2-expressing cells .

Clinical and Therapeutic Implications

DiseaseMitoferrin InvolvementPotential Interventions
GlioblastomaMFRN1 upregulation drives proliferationMFRN1 inhibitors to reduce tumor growth
Erythropoietic ProtoporphyriaImpaired heme synthesis due to MFRN1 mutationsGene therapy to restore iron transport
Mitochondrial DisordersIron-sulfur cluster deficits from MFRN2 lossSupplementation with Fe-S cluster precursors

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquotting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
mfn-1; CBG02884; Mitoferrin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
mfn-1
Target Protein Sequence
MGGGGEDEYESLPTHSIPVHLAAGALAGAVEHCVMFPFDSVKTRMQSLCPCETKCPTPVH SLMSIVKREGWLRPLRGVNAVAAGSMPAHALYFTVYEKMKSFLTGNTAGHEHTLAYGASG VVATLIHDAVMNPAEVVKQRMQMAYSPYGSSLECARCVYNREGFAAFYRSYTTQLAMNVP FQAIHFMGYEFWQQVLNPEHKYDPKSHLIAGGLAGGLAAAVTTPMDCVKTVLNTQQAAEA DPSNRRIFLKARYRYRGISDAVRTIYSQRGMAGFSCGLQARVIFQVPATALSWSVYELFK FMLSFEGGHSS
Uniprot No.

Target Background

Function
Mitochondrial iron transporter that mediates iron uptake. This protein is likely essential for heme synthesis of hemoproteins and Fe-S cluster assembly.
Database Links

KEGG: cbr:CBG02884

STRING: 6238.CBG02884

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Mitoferrin (CBG02884) and what is its primary function in cellular metabolism?

Mitoferrin (CBG02884) is a mitochondrial solute carrier protein from Caenorhabditis briggsae that facilitates iron transport across the mitochondrial membrane. It belongs to the mitoferrin family (gene name: mfn-1) and functions as a critical component in mitochondrial iron acquisition pathways . Mitoferrins are essential for multiple iron-dependent mitochondrial processes, including heme biosynthesis and iron-sulfur cluster assembly. Studies have demonstrated that reductions in mitoferrin levels result in decreased mitochondrial iron accumulation, impaired heme synthesis, and defective iron-sulfur cluster production . The protein consists of 311 amino acids and has the UniProt ID Q620A6 .

Methodologically, when studying mitoferrin function, researchers should consider using both gain-of-function approaches (overexpression) and loss-of-function techniques (RNA interference, gene knockout) to comprehensively characterize its role in iron metabolism across different cellular contexts.

How should recombinant Mitoferrin (CBG02884) be stored and handled in laboratory settings?

For optimal stability and activity, recombinant Mitoferrin (CBG02884) should be stored according to these research-validated protocols:

  • Upon receipt, briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended standard is 50%)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C/-80°C

Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein stability and activity. For experimental reproducibility, researchers should document reconstitution conditions, storage duration, and number of freeze-thaw cycles in their methodology sections.

How does Mitoferrin-1 interact with other proteins to regulate mitochondrial iron import?

Mitoferrin-1 physically interacts with the ATP-binding cassette transporter Abcb10 to facilitate mitochondrial iron import, particularly in erythroid cells. This interaction has been rigorously confirmed through multiple complementary approaches:

  • Co-immunoprecipitation studies: Endogenous Abcb10 was shown to be enriched as an oligomeric complex with Mitoferrin-1 in differentiated MEL (murine erythroleukemia) cells .

  • Heterologous expression systems: The physical interaction was validated in COS7 cells transiently co-transfected with Myc-tagged Abcb10 and FLAG-tagged Mitoferrin-1 .

  • Domain mapping: The interaction domain was localized to amino acids 26-50 at the N-terminus of Mitoferrin-1 through chimeric protein studies .

This interaction is functionally significant as it substantially enhances Mitoferrin-1 protein stability. Pulse-chase experiments demonstrated that co-expression with Abcb10 greatly extended the half-life of Mitoferrin-1 . Importantly, this interaction is selective - Mitoferrin-2 does not interact with Abcb10 in differentiated erythroid cells, and neither Mitoferrin-1 nor Mitoferrin-2 interacts with the unrelated mitochondrial transporter Abcb6 .

For researchers investigating similar protein-protein interactions, it is recommended to employ multiple complementary techniques including affinity purification, co-immunoprecipitation, and functional assays to establish both physical association and physiological relevance.

What are the functional differences between Mitoferrin-1 and Mitoferrin-2, and how should these be considered in experimental design?

Mitoferrin-1 and Mitoferrin-2 exhibit distinct expression patterns and functional properties that should be carefully considered when designing experiments:

Expression Patterns:

  • Mitoferrin-1 is highly expressed in hematopoietic organs, fetal liver, adult bone marrow, and spleen

  • Mitoferrin-2 is ubiquitously expressed at low levels across multiple tissues

Functional Differences:

  • Protein stability regulation: Mitoferrin-1's half-life increases significantly in differentiated erythroid cells, while Mitoferrin-2's half-life remains unchanged during differentiation .

  • Protein interactions: Mitoferrin-1 selectively interacts with Abcb10 in differentiated erythroid cells, whereas Mitoferrin-2 does not form this interaction .

  • Functional complementation: While both proteins contribute to mitochondrial iron delivery in various cells, only Mitoferrin-1 can support hemoglobinization in erythroid cells. Mitoferrin-2 cannot restore heme synthesis in erythroid cells deficient in Mitoferrin-1 due to its inability to accumulate in mitochondria in these cells .

In experimental design, researchers should:

  • Use tissue-specific promoters when studying each mitoferrin isoform in vivo

  • Include both isoforms as controls in functional studies

  • Consider the differentiation state of cells when interpreting results

  • Employ isoform-specific antibodies or tagged constructs to distinguish between the two proteins

What methodologies are most effective for studying the role of Mitoferrin in iron metabolism and heme synthesis?

To comprehensively investigate Mitoferrin's role in iron metabolism and heme synthesis, researchers should employ these methodological approaches:

1. Genetic Manipulation Approaches:

  • RNA interference (RNAi) to reduce mitoferrin levels

  • CRISPR-Cas9 gene editing for complete knockout

  • Transgenic expression of wild-type or mutant mitoferrin

  • Chimeric protein expression to analyze domain functions

2. Protein-Protein Interaction Analyses:

  • Co-immunoprecipitation with putative interaction partners

  • Proximity labeling techniques (BioID, APEX)

  • Fluorescence resonance energy transfer (FRET)

  • Split-GFP complementation assays

3. Functional Assays:

  • Mitochondrial iron uptake measurements

  • Heme synthesis quantification

  • Iron-sulfur cluster assembly assessment

  • Pulse-chase assays to determine protein half-life

4. Localization Studies:

  • Subcellular fractionation to isolate mitochondria

  • Immunofluorescence microscopy with organelle markers

  • Epitope tagging combined with confocal microscopy

5. In Vivo Functional Complementation:

  • Rescue experiments in model organisms (e.g., frs embryos)

  • Tissue-specific expression to determine cell type requirements

When designing these experiments, researchers should include appropriate controls for both gain-of-function and loss-of-function approaches, and consider the differential expression of mitoferrin isoforms across tissues and developmental stages.

How is Mitoferrin expression regulated at the post-transcriptional level by microRNAs?

Recent research has revealed that mitoferrin expression can be regulated post-transcriptionally by microRNAs, specifically miR-8-3p in Bactrocera dorsalis (oriental fruit fly). This represents the first documented case of miRNA-mediated regulation of a mitoferrin .

Experimental Evidence:

  • Dietary treatment of adult male flies with miR-8-3p mimic altered mitoferrin expression in the testes

  • Conversely, treatment with miR-8-3p antagomiR (inhibitor) also affected mitoferrin expression

  • These alterations in mitoferrin expression resulted in reduced male reproductive capacity due to decreased numbers and viability of spermatozoa

Methodological Approaches for Studying miRNA Regulation:

  • Target Prediction and Validation:

    • Bioinformatic prediction of miRNA binding sites in mitoferrin mRNA

    • Luciferase reporter assays with wild-type and mutated mitoferrin 3'UTR constructs

  • Functional Analysis:

    • Dietary delivery of miRNA mimics or antagomiRs

    • Direct injection of mimics/antagomiRs

    • Transgenic expression of miRNAs or target protectors

  • Phenotypic Assessment:

    • Measurement of mitoferrin protein and mRNA levels

    • Assessment of mitochondrial iron content

    • Evaluation of cellular functions dependent on mitoferrin (e.g., spermatogenesis)

This research has implications beyond basic science, as targeting mitoferrin expression via miRNA, antagomiRs, or dsRNA represents a potential approach for developing non-radiated and non-transgenic Sterile Insect Technique (SIT) methods for pest control .

What role does Mitoferrin play in spermatogenesis, and how can it be experimentally investigated?

Mitoferrin has been demonstrated to play a critical role in spermatogenesis, particularly through its function in mitochondrial iron metabolism . The relationship between mitoferrin and reproductive capacity provides a valuable model system for studying iron metabolism in a specialized cellular context.

Evidence of Mitoferrin's Role in Spermatogenesis:

  • Alterations in mitoferrin expression in the testes of Bactrocera dorsalis resulted in reduced male reproductive capacity

  • Specifically, these alterations led to decreased numbers and viability of spermatozoa

  • Previous studies in Drosophila melanogaster showed that mitoferrin defects resulted in abnormal spermatogenesis

Experimental Approaches for Investigating Mitoferrin in Spermatogenesis:

  • Genetic Manipulation:

    • miRNA-based regulation (miR-8-3p mimics or antagomiRs)

    • RNA interference using mitoferrin-specific dsRNA

    • Conditional knockout in testis-specific cells

  • Analytical Methods:

    • Histological examination of testes

    • Sperm count and viability assessments

    • Electron microscopy to examine mitochondrial morphology

    • Measurement of iron content in sperm mitochondria

  • Functional Studies:

    • Male fertility assays

    • In vitro fertilization experiments

    • Sperm motility analysis

    • ATP production measurement

These approaches can be applied across model organisms, including Drosophila, mice, and potentially human samples, to comprehensively understand mitoferrin's conserved functions in spermatogenesis and reproductive biology.

What are the critical considerations when designing experiments with recombinant Mitoferrin (CBG02884)?

When designing experiments with recombinant Mitoferrin (CBG02884), researchers should address these critical considerations:

1. Protein Quality and Handling:

  • Verify protein purity (>90% by SDS-PAGE is recommended)

  • Reconstitute properly in appropriate buffer systems

  • Minimize freeze-thaw cycles by preparing single-use aliquots

  • Include controls for protein denaturation

2. Experimental Controls:

  • Use appropriate negative controls (e.g., empty vector, unrelated proteins)

  • Include positive controls when possible (e.g., known interacting partners)

  • Perform validation with both tagged and untagged versions to control for tag interference

3. Functional Assays:

  • Consider the specific mitoferrin isoform being studied (Mitoferrin-1 vs. Mitoferrin-2)

  • Account for cell type-specific effects (erythroid vs. non-erythroid cells)

  • Measure multiple endpoints (iron import, protein stability, heme synthesis)

4. Protein Interactions:

  • Validate interactions using multiple complementary techniques

  • Consider the differential stability of protein complexes under various extraction conditions

  • Control for non-specific binding, particularly with epitope tags

5. Iron Metabolism Considerations:

  • Control iron availability in experimental media

  • Account for background iron levels and iron-binding proteins

  • Consider the effects of cell differentiation state on iron metabolism

How can researchers troubleshoot common challenges when working with Mitoferrin proteins?

Researchers frequently encounter several challenges when working with Mitoferrin proteins. Here are methodological approaches to address these issues:

1. Poor Protein Stability:

  • Problem: Mitoferrin proteins may exhibit limited stability after reconstitution

  • Solution: Add glycerol (5-50%) to storage buffer; maintain strict temperature control; avoid repeated freeze-thaw cycles

2. Low Expression Levels:

  • Problem: Difficulty detecting endogenous Mitoferrin expression

  • Solution: Use optimized antibodies; consider enrichment by subcellular fractionation; attempt detection during differentiation when expression may increase

3. Protein-Protein Interaction Artifacts:

  • Problem: Non-specific interactions in pull-down experiments

  • Solution: Include stringent washing steps; use crosslinking approaches; validate interactions with multiple techniques; employ domain mapping strategies

4. Functional Redundancy:

  • Problem: Compensatory effects between Mitoferrin-1 and Mitoferrin-2

  • Solution: Employ simultaneous knockdown/knockout of both isoforms; use isoform-specific rescue experiments; consider tissue-specific approaches

5. Phenotypic Analysis Complications:

  • Problem: Difficulty distinguishing direct vs. indirect effects of Mitoferrin manipulation

  • Solution: Include time-course experiments; employ acute induction systems; measure immediate downstream effects (iron uptake) alongside long-term consequences (heme levels)

6. Mitochondrial Localization Issues:

  • Problem: Impaired mitochondrial targeting of recombinant Mitoferrin

  • Solution: Verify proper targeting using subcellular fractionation and confocal microscopy; ensure tag placement doesn't interfere with targeting signals; consider using mitochondria-targeted fluorescent proteins as controls

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.