Recombinant Mitoferrin (W02B12.9)

What is Mitoferrin (W02B12.9) and why is it significant for research?

Mitoferrin (W02B12.9), also known as mfn-1, is a protein belonging to the mitochondrial solute carrier family. It is the sole homologue of vertebrate mitoferrin 1/2 and yeast MRS3/4 in Caenorhabditis elegans. The significance of this protein lies in its evolutionary conservation and its role in iron homeostasis regulation and iron-sulfur cluster biogenesis . The full-length protein consists of 312 amino acids and is frequently used in studies investigating mitochondrial iron transport mechanisms and metabolic regulation . Studying this protein provides valuable insights into conserved cellular processes across species, from yeast to humans.

What is the molecular structure and genetic profile of Mitoferrin (W02B12.9)?

Mitoferrin (W02B12.9) localizes to the reverse strand of chromosome 2 in C. elegans and has four exons. The protein is predicted to contain 321 amino acids with a molecular weight of approximately 34.1 kD . The amino acid sequence identities between W02B12.9 and its counterparts in human, Drosophila, or yeast species exceed 40%, indicating significant evolutionary conservation . Importantly, the predicted transmembrane regions show high conservation across species, suggesting functional importance of these domains . The complete amino acid sequence is: MGGGGEDEYESLPTHSVPVHLTAGALAGAVEHCVMFPFDSVKTRMQSLCPCPETKCPTPVHSLMSIVKREGWLRPLRGVNAVAAGSMPAHALYFTVYEKMKGYLTGNSAGHSNTLAYGASGVVATLIHDAIMNPAEVVKQRMQMAFSPYGSSLECARCVYNREGVAAFYRSYTTQLAMNVPFQAIHFMSYEFWQHVLNPEHKYDPKSHLIAGGLAGGLAAALTTPMDCVKTVLNTQQAAEADPANRRIFLQARYRYRGISDAVRTIYSQRGLSGFSCGLQARVIFQVPATALSWSVYELFKFMLSFEGGHSS .

What are the optimal protocols for handling recombinant Mitoferrin (W02B12.9)?

For optimal handling of recombinant Mitoferrin (W02B12.9), the protein should be briefly centrifuged before opening to ensure contents settle at the bottom of the vial. Reconstitution should be performed in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the standard protocol) and aliquot the solution for storage at -20°C/-80°C . Repeated freeze-thaw cycles should be strictly avoided as they significantly degrade protein quality. Working aliquots can be stored at 4°C but should be used within one week . The protein is supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which provides optimal stability during storage .

How can researchers effectively design RNAi experiments targeting Mitoferrin (W02B12.9)?

For effective RNAi experiments targeting W02B12.9, researchers should:

• Design sequence-specific fragments corresponding to the exons of W02B12.9, preferably targeting the second exon as demonstrated in published protocols .

• Confirm sequence specificity through BLAST searches against the worm genome database to avoid off-target effects .

• Use PCR primers with appropriate restriction enzyme sites for cloning, such as:

  • Forward: 5′-GTTAGATCTCTGAAACGAAATGTCCA-3′ (Bgl II)

  • Reverse: 5′-TAAGGTACCAAGTCCTCCCGCAA-3′ (Kpn I)

• Clone the PCR product into an appropriate vector such as L4440 .

• Transform the RNAi vector into E. coli RNase III-deficient strain HT115 (DE3) .

• Culture the transformed bacteria in LB medium with appropriate antibiotics (50 μg/ml ampicillin) and induce with 1 mM IPTG overnight .

• Transfer L4 staged hermaphrodite worms onto the bacterial lawn and incubate at 20°C for the RNAi to take effect .

• Include appropriate controls using bacteria transformed with empty vector L4440 .

For enhanced RNAi effects, especially in tissues like neurons that are traditionally refractory to RNAi, consider using RNAi hypersensitive strains such as eri-1(mg366) IV .

How does Mitoferrin (W02B12.9) knockdown affect longevity in C. elegans models?

Downregulation of Mitoferrin (W02B12.9) through RNAi techniques has demonstrated significant lifespan extension effects in C. elegans. Multiple independent experiments have consistently shown that mfn-1 RNAi treatment extends both mean and maximum lifespan . The table below summarizes findings from lifespan assays conducted at 20°C:

The consistency across multiple experiments demonstrates robust lifespan extension, with mfn-1 RNAi treatment increasing maximum lifespan by 50-77% and mean lifespan by approximately 48-61% . In RNAi hypersensitive strains like eri-1, where neurons are also sensitive to RNAi, the treatment more than doubled the lifespan . These findings suggest that iron metabolism and mitochondrial function, as regulated by Mitoferrin, play crucial roles in the aging process of C. elegans.

What techniques are most effective for quantifying Mitoferrin (W02B12.9) expression levels?

For accurate quantification of Mitoferrin (W02B12.9) expression levels, quantitative real-time PCR (qRT-PCR) has proven to be highly effective. The recommended methodology involves:

• Isolate total RNA from worm pellets (approximately 10-15 μl) using Trizol reagent after RNAi treatment .

• Verify RNA integrity through 2% agarose gel electrophoresis and quantify spectrophotometrically .

• Convert RNA to cDNA using appropriate reverse transcription kits (e.g., PrimeScript RT reagent kit) .

• Perform qRT-PCR using SYBR-based detection systems with the following cycling conditions: 95°C for 30 seconds, followed by 40 cycles of 5 seconds at 95°C and 30 seconds at 60°C .

• Use the following primers designed to span introns (preventing genomic DNA amplification):

  • W02B12.9 Forward: 5′-GGCGAATTTTCTTGCAGGCT-3′

  • W02B12.9 Reverse: 5′-TCAACTCGAATGACCTCCTT-3′

• Normalize expression levels to appropriate housekeeping genes such as act-1:

  • act-1 Forward: 5′-CCGCTCTTGCCCCATCAAC-3′

  • act-1 Reverse: 5′-AAGCACTTGCGGTGAACGATG-3′

• Confirm amplification specificity through melting curve analysis .

• Perform at least three independent biological replicates to ensure reproducibility .

This approach provides reliable quantification of W02B12.9 mRNA levels and can effectively verify RNAi knockdown efficiency.

What are common challenges in purifying recombinant Mitoferrin (W02B12.9) and how can they be overcome?

Recombinant Mitoferrin (W02B12.9) purification presents several challenges due to its transmembrane nature. Based on established protocols, researchers should consider these issues and solutions:

• Protein Solubility: As a member of the mitochondrial carrier family, Mitoferrin contains multiple transmembrane domains that make it inherently hydrophobic. The His-tagged recombinant form expressed in E. coli achieves purity greater than 90% as determined by SDS-PAGE . To enhance solubility during purification, use appropriate detergents or chaotropic agents during initial extraction steps, followed by careful refolding if necessary.

• Protein Stability: Maintain stability by storing in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . The addition of trehalose is particularly important as it serves as a protein stabilizer during freeze-drying and storage.

• Activity Preservation: Due to the sensitive nature of membrane proteins, functional activity can be lost during purification. Add glycerol (5-50%) to the final preparation to preserve functional integrity during storage . Aliquot the protein solution to avoid repeated freeze-thaw cycles, which significantly reduce protein quality.

• Expression System Optimization: The standard protocol uses E. coli as the expression system , which may pose challenges for proper folding of eukaryotic membrane proteins. Consider optimizing expression conditions, including temperature, IPTG concentration, and induction time to improve yield and solubility.

How can researchers address variability in RNAi efficiency when studying Mitoferrin (W02B12.9)?

RNAi efficiency variability is a significant challenge when studying Mitoferrin (W02B12.9). Research indicates that RNAi technology, while valuable for functional studies in C. elegans, often cannot completely inhibit gene expression and shows considerable inter-experimental variations . To address these limitations:

• Design Multiple RNAi Constructs: Target different regions of the W02B12.9 gene to ensure robust knockdown. Published protocols have successfully used constructs targeting both genomic DNA and cDNA templates with different primer sets .

• Quantify Knockdown Efficiency: Always verify RNAi efficiency through qRT-PCR using intron-spanning primers to specifically measure mRNA levels .

• Use RNAi Hypersensitive Strains: For more robust phenotypes, especially when studying tissues like neurons that are traditionally refractory to RNAi, use hypersensitive strains like eri-1(mg366) IV . These strains have demonstrated more pronounced effects, including more than doubled lifespan extension compared to wild-type strains.

• Control for False Positives/Negatives: Be aware that cross-contamination and off-target effects may occur. False-negative rates in RNAi screens can exceed 50%, and in postembryonic phenotype studies, rates may surpass 80% . Design appropriate controls and validate findings through multiple approaches.

• Optimize RNAi Conditions: Factors such as temperature, IPTG concentration, and exposure time can significantly affect RNAi efficiency. The standard protocol uses 1 mM IPTG for overnight induction at room temperature before transferring L4 staged hermaphrodites to the bacterial lawn .

How conserved is Mitoferrin (W02B12.9) across species and what are the implications for translational research?

Mitoferrin (W02B12.9) demonstrates remarkable evolutionary conservation across species, making it valuable for translational research. The protein shows amino acid sequence identities exceeding 40% when compared with human, Drosophila, and yeast mitoferrin proteins . This high degree of conservation is particularly evident in the predicted transmembrane regions, suggesting functional importance maintained throughout evolution .

C. elegans has only one mitoferrin (mfn-1), whereas vertebrates have two paralogs (mitoferrin-1 and mitoferrin-2), and yeast has MRS3 and MRS4 . This suggests that invertebrate mitoferrin likely performs functions that have been divided between specialized paralogs in higher organisms. The singular nature of C. elegans mitoferrin makes it an excellent model for studying basic mitoferrin functions without the complexity of paralog-specific effects.

The evolutionary conservation of mitoferrin has significant implications for translational research:

• Findings regarding basic mechanisms of mitoferrin function in C. elegans may be applicable across species, including humans, especially for conserved processes like iron transport and mitochondrial function.

• The substantial lifespan extension observed with mfn-1 knockdown in C. elegans suggests that modulation of mitoferrin activity could potentially impact aging processes in higher organisms .

• Proteins involved in iron homeostasis regulation and iron-sulfur cluster biogenesis are typically conserved in evolution, suggesting fundamental importance to cellular function across all eukaryotes .

What are the key structural and functional differences between C. elegans Mitoferrin (W02B12.9) and human mitoferrins?

While C. elegans Mitoferrin (W02B12.9) shares significant homology with human mitoferrins, several key structural and functional differences exist that researchers should consider:

Structural Differences:

• C. elegans possesses a single mitoferrin gene (mfn-1), while humans have two distinct mitoferrin proteins (mitoferrin-1 and mitoferrin-2) . This suggests functional specialization in humans that is managed by a single protein in C. elegans.

• Sequence analysis indicates that W02B12.9 is predicted to have 321 amino acids , while the recombinant form is described as having 312 amino acids . This discrepancy might be due to different annotation versions or post-translational processing.

• The amino acid sequence identity between W02B12.9 and human mitoferrins is approximately 40% , indicating conserved regions but also suggesting species-specific domains that may confer unique regulatory or functional properties.

Functional Implications:

• The expression pattern of W02B12.9 spans from embryo to adult stages in various tissues including intestine and neurons , suggesting broad physiological roles throughout the organism's life cycle.

• Human mitoferrin-1 is predominantly expressed in erythroid cells, while mitoferrin-2 shows broader tissue distribution. C. elegans mfn-1 likely encompasses functions of both human paralogs.

• The single mitoferrin in C. elegans suggests less functional redundancy compared to mammals, potentially making the worm more sensitive to complete mitoferrin loss. This could explain why knockdown (rather than complete knockout) extends lifespan , as some residual function may be necessary for viability.

These differences highlight both the value and limitations of using C. elegans as a model for studying mitoferrin function in the context of human health and disease.

What are promising unexplored aspects of Mitoferrin (W02B12.9) function that warrant investigation?

Several promising aspects of Mitoferrin (W02B12.9) function remain unexplored and merit further investigation:

• Mechanistic Basis of Lifespan Extension: While mfn-1 RNAi treatment has been shown to significantly extend lifespan in C. elegans , the precise molecular mechanisms underlying this effect remain unclear. Future research should investigate whether this effect is mediated through altered iron metabolism, reduced oxidative stress, changes in mitochondrial function, or activation of specific longevity pathways.

• Tissue-Specific Functions: The expression of W02B12.9 in multiple tissues, including intestine and neurons , suggests diverse physiological roles. Research using tissue-specific RNAi or expression systems could elucidate how mitoferrin function varies across different cell types and which tissues are responsible for the observed lifespan extension.

• Interaction with Iron-Sulfur Cluster Biogenesis Machinery: Given that proteins involved in iron homeostasis regulation and iron-sulfur cluster biogenesis are typically conserved in evolution , investigating the interaction between mitoferrin and iron-sulfur cluster assembly proteins could reveal important insights into cellular energy metabolism and oxidative stress responses.

• Post-Translational Regulation: Research into how post-translational modifications affect mitoferrin function could identify regulatory mechanisms that might be manipulated for therapeutic purposes in iron metabolism disorders.

• Stress Response Integration: Exploring how mitoferrin function changes under various stress conditions (oxidative, heat, dietary restriction) could reveal its role in stress adaptation and resilience pathways.

What emerging technologies might enhance research on Mitoferrin (W02B12.9)?

Emerging technologies offer exciting opportunities to advance Mitoferrin (W02B12.9) research:

• CRISPR/Cas9 Genome Editing: While RNAi has been valuable for studying mfn-1 function , precise genome editing using CRISPR/Cas9 could generate clean knockout models or introduce specific mutations to study structure-function relationships with greater precision than RNAi approaches, which often have incomplete knockdown and potential off-target effects.

• High-Resolution Cryo-EM: Applying cryo-electron microscopy techniques to determine the high-resolution structure of Mitoferrin could reveal important insights about its transmembrane domains and substrate binding sites, potentially identifying druggable pockets for therapeutic development.

• Metabolomics Integration: Comprehensive metabolomic profiling of mfn-1 knockdown or knockout models could identify altered metabolic pathways beyond iron metabolism, providing insights into the broader physiological impact of mitoferrin function.

• Single-Cell Transcriptomics: Analyzing gene expression changes at the single-cell level in response to mitoferrin modulation could reveal cell type-specific responses and identify new potential interacting partners or pathways.

• In vivo Iron Imaging: Development of non-invasive methods to visualize and quantify iron distribution and dynamics in living organisms could provide real-time insights into how mitoferrin affects iron trafficking and utilization across different tissues and under various physiological conditions.

• Protein-Protein Interaction Mapping: Advanced interactome analysis using BioID or proximity labeling approaches could identify the complete network of mitoferrin-interacting proteins in different cellular compartments, revealing new functional connections.