Recombinant Mobala virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
260-491
Protein Length
Full Length of Mature Protein
Species
Mobala mammarenavirus (isolate Rat/Central African Republic/Acar 3080/1983) (MOBV)
Target Names
GPC
Target Protein Sequence
GTFTWTLSDSEGNDLPGGYCLQRWMLIEAEMKCFGNTAVAKCNQQHDEEFCDMLRLFDFN KEAIHRLRVEAEKSISLINKAVNSLINDQLIMRNHLRDIMGIPYCNYSRFWYLNDTRSGR TSLPKCWMVSNGSYLNETHFSSDIEQEANNMITEMLRKEYERRQGTTPLGLVDLFVFSTS FYLISVFLHLIKIPTHRHLVGKPCPKPHRLNHMGVCSCGLYKQPGLPTKWKR
Uniprot No.

Target Background

Function
Recombinant Mobala virus Pre-glycoprotein polyprotein GP complex (GPC) is a class I viral fusion protein. It mediates fusion between viral and host endosomal membranes, delivering the nucleocapsid into the cytoplasm. This fusion is triggered by irreversible conformational changes induced by endosomal acidification. The stable signal peptide (SSP) is cleaved, functioning as a signal peptide while also remaining a component of the GP complex. SSP is essential for efficient glycoprotein expression, post-translational GP1/GP2 cleavage, glycoprotein transport to the cell membrane, infectious virion formation, and pH-dependent cell fusion. The GPC interacts with the host receptor, mediating virus attachment to alpha-dystroglycan (DAG1), leading to virion internalization primarily via clathrin- and caveolin-independent endocytosis.
Database Links

KEGG: vg:5075845

Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the Mobala virus pre-glycoprotein polyprotein GP complex and how is it processed in viral replication?

The Mobala virus pre-glycoprotein polyprotein GP complex (GPC) is a crucial surface protein responsible for viral entry into host cells. Similar to other arenaviruses, the GPC is initially synthesized as a single precursor protein that undergoes post-translational processing. The pre-glycoprotein is cleaved into three functional subunits: the stable signal peptide (SSP), glycoprotein 1 (GP1), and glycoprotein 2 (GP2) . This processing is essential for viral infectivity.

The cleavage of GPC into GP1 and GP2 is mediated by the cellular proprotein convertase site 1 protease (S1P), recognizing a specific consensus motif R-(R/K/H)-L-(A/L/S/T/F) . For Mobala virus specifically, the recognition sequence RRLM is conserved, similar to what is found in Ippy virus . This proteolytic processing is critical for the functional maturation of the glycoprotein complex.

What are the optimal methods for isolating and culturing Mobala virus for GPC research?

Isolation and cultivation of Mobala virus require specific biosafety procedures and methodologies similar to those used for related arenaviruses. Based on documented approaches, the following protocol has proven effective:

  • Initial isolation: Intracerebral infection of 2-day-old newborn mice, with serial passages up to the sixth passage .

  • Long-term conservation: Lyophilization (freeze-drying) of viral isolates for room temperature storage .

  • Reactivation and amplification:

    • Dilute lyophilized virus in 1X PBS solution

    • Inoculate newborn mice (24-72 hours old)

    • Harvest brain tissue from mice that succumb after 7 days

    • Prepare brain suspension in 1X PBS and filter

  • Cell culture propagation:

    • Infect confluent Vero E6 cells with filtered brain suspension

    • Use Dulbecco's Modified Eagle's Medium (DMEM) supplemented with 2% Fetal Calf Serum

    • Include antimicrobial solution (10,000 units/mL penicillin, 10,000 μg/mL streptomycin, 25 μg/mL amphotericin B)

    • Monitor cultures for 7 days for cytopathic effects

For recombinant protein work, expression systems capable of proper post-translational processing should be prioritized to ensure proper folding and glycosylation of the GPC.

What experimental approaches are most effective for studying Mobala virus GPC-mediated cell entry?

Studying Mobala virus GPC-mediated cell entry requires a combination of molecular, biochemical, and imaging techniques. Although specific data for Mobala virus is limited, approaches used for related arenaviruses can be adapted:

  • Receptor identification studies:

    • Cell binding assays with recombinant GPC

    • Competition assays with known arenavirus receptors

    • Co-immunoprecipitation of GPC with potential receptor molecules

  • Fusion mechanism analysis:

    • pH-dependent fusion assays to determine optimal conditions for GPC-mediated fusion

    • Site-directed mutagenesis of the RRLM cleavage site to assess processing requirements

    • Membrane fusion monitoring using fluorescent lipid mixing assays

  • Conformational change investigation:

    • Analysis of GPC structure under varying pH conditions that mimic endosomal environments

    • Epitope mapping using monoclonal antibodies to track conformational changes

    • Cryo-electron microscopy to visualize pre- and post-fusion conformations

These methodologies would help elucidate the specific mechanisms by which Mobala virus GPC mediates viral entry into target cells, particularly in its natural host environment.

How has Mobala virus GPC evolved compared to other arenavirus glycoproteins?

Molecular clock analysis indicates that Mobala virus diverged significantly from closely related arenaviruses. Studies show that strain AnRB3214, initially misidentified as Ippy virus but later shown to be a Mobala virus variant, diverged from the main Mobala virus lineage approximately 400 years ago . This substantial evolutionary distance highlights the genetic plasticity of arenaviruses and their ability to adapt to different ecological niches.

The evolutionary relationship between Mobala virus and other arenaviruses can be summarized in this comparative table:

VirusNucleic Acid Similarity to AnRB3214Geographic DistributionPrimary Host
Mobala virus68-79%Central African RepublicPraomys sp.
Gairo virus68-79%TanzaniaRodents
Luna virusMore similar to Mobala than to Mopeia/MorogoroZambiaRodents
Ippy virusLess similar (initially misidentified)Central African RepublicArvicanthis sp.
Lassa virusMore distantWest AfricaMastomys sp.

The GPC sequence conservation pattern suggests functional constraints on certain regions critical for viral entry, while allowing variation in others, possibly reflecting adaptation to different host species or immune pressure .

What are the significant genetic and structural differences between Mobala virus GPC and the well-studied Lassa virus GPC?

Although both Mobala virus and Lassa virus belong to the Old World arenavirus group, their GPCs exhibit important differences that reflect their distinct evolutionary trajectories and host adaptations:

  • Recognition site differences: While both viruses use the S1P cellular protease for GPC processing, Mobala virus has the RRLM recognition motif, which differs from Lassa virus's cleavage site .

  • Receptor usage: Lassa virus GPC is known to undergo a unique receptor switch during entry, first engaging with α-dystroglycan and then switching to LAMP1 in the late endosome . The specific receptor usage of Mobala virus GPC remains to be fully characterized but may differ given its distinct host range.

  • Fusion mechanisms: Lassa virus GPC contains two separate fusion peptides in its fusion domain, an unusual feature for class I viral fusion proteins . Whether Mobala virus GPC shares this characteristic requires further investigation.

  • Host range determinants: The structural differences in the GP1 receptor-binding domain likely contribute to the different host specificities, with Lassa virus primarily infecting Mastomys rodents and Mobala virus found in Praomys species .

These differences have significant implications for viral pathogenesis, host range, and potential therapeutic interventions targeting viral entry.

How do quasispecies dynamics affect Mobala virus GPC function and evolution?

Arenaviruses, including Mobala virus, exist as quasispecies - collections of closely related viral genomes subject to genetic variation, competition, and selection. This genetic diversity has profound implications for viral adaptation and host interactions .

The quasispecies nature of arenaviruses impacts GPC function and evolution through several mechanisms:

  • Adaptive flexibility: The generation of GPC variants allows rapid adaptation to changing environments, including new host species, tissue tropisms, or immune pressures.

  • Immune evasion: GPC variants can emerge that escape neutralizing antibodies targeting the original dominant epitopes, particularly in the exposed GP1 domain.

  • Receptor binding plasticity: Subtle variations in the receptor-binding domain of GP1 might alter affinity for cellular receptors, potentially expanding host range or cell tropism.

  • Processing efficiency: Mutations near the S1P cleavage site (RRLM in Mobala virus) could affect processing efficiency and thus viral infectivity.

Research approaches to study these dynamics include:

  • Deep sequencing of viral populations from different hosts or tissues

  • In vitro evolution experiments under selective pressures

  • Functional characterization of different GPC variants

  • Computational modeling of selection pressures on specific GPC domains

What methodological approaches can resolve the three-dimensional structure of Mobala virus GPC in different conformational states?

Determining the three-dimensional structure of Mobala virus GPC in its pre- and post-fusion conformations presents significant challenges but would provide invaluable insights into the mechanism of viral entry. Based on approaches used for related viruses, the following methodologies are recommended:

  • Cryo-electron microscopy (cryo-EM):

    • Generate stable recombinant GPC trimers in both pre-fusion and post-fusion states

    • Use structure-based design to stabilize these conformations

    • Apply single-particle cryo-EM analysis to resolve structures at sub-4Å resolution

  • X-ray crystallography:

    • Express and purify GPC fragments amenable to crystallization

    • Generate Fab fragments from neutralizing antibodies to stabilize specific conformations

    • Co-crystallize GPC-Fab complexes to facilitate structural determination

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Map conformational dynamics and solvent accessibility of different GPC domains

    • Compare conformational changes under various pH conditions that mimic the endosomal environment

  • Molecular dynamics simulations:

    • Model the structural transitions between different conformational states

    • Identify potential intermediate structures during the fusion process

    • Predict effects of specific mutations on conformational stability

These approaches, used in combination, would provide complementary structural information to elucidate the molecular mechanisms of Mobala virus entry.

What cellular factors are critical for Mobala virus GPC-mediated entry into host cells?

Understanding the cellular factors required for Mobala virus entry is essential for defining host range and developing potential therapeutic interventions. While specific data on Mobala virus is limited, research on related arenaviruses suggests several critical host factors:

  • Cellular receptors: Mobala virus likely uses specific cell surface receptors for initial attachment. Studies should investigate whether it utilizes α-dystroglycan like Lassa virus or alternative receptors .

  • Endosomal factors: Arenavirus entry typically requires endocytosis and trafficking through increasingly acidic endosomal compartments. Experiments using endosomal acidification inhibitors could determine the pH-dependence of Mobala virus entry.

  • Proteolytic processing: The cellular subtilisin kexin isozyme-1/site 1 protease (SKI-1/S1P) is essential for GPC cleavage, recognizing the RRLM motif in Mobala virus GPC . Inhibition or knockout studies of this protease would help quantify its importance for viral infectivity.

  • Late endosomal factors: For Lassa virus, the late endosomal protein LAMP1 serves as a critical intracellular receptor . Investigating whether Mobala virus requires similar intracellular receptor switching would be valuable.

A methodical approach to identifying these factors would involve:

  • CRISPR knockout screens to identify essential host factors

  • Pharmacological inhibition studies targeting specific cellular pathways

  • Co-localization studies tracking viral entry through various cellular compartments

  • Receptor binding assays with recombinant GPC

How does Mobala virus GPC contribute to immune evasion and persistence in natural reservoir hosts?

The ability of arenaviruses to establish persistent infections in their natural rodent hosts suggests sophisticated immune evasion strategies, with GPC likely playing a central role. Evidence from related arenaviruses indicates several potential mechanisms:

  • GPC shielding: The heavily glycosylated nature of arenavirus GPCs may shield critical epitopes from antibody recognition. Analysis of glycosylation patterns on Mobala virus GPC could reveal immune evasion strategies.

  • Receptor interference: GPC expression on infected cells may downregulate or interfere with host receptors, potentially limiting superinfection and modulating immune detection.

  • Immunoregulatory properties: Studies should investigate whether Mobala virus GPC directly interacts with immune components, as seen with some viral glycoproteins that bind to immune receptors.

  • Natural reservoir adaptation: In Praomys rodents, the natural host for Mobala virus, seroprevalence studies have shown infection rates of 7.7% and 3.2% in different villages in the Central African Republic . This suggests a balanced host-pathogen relationship that allows viral persistence without causing severe disease.

Research approaches to address these questions include:

  • Comparative infection studies in reservoir versus non-reservoir hosts

  • Immunological profiling during acute versus persistent infection phases

  • GPC mutational studies to identify domains involved in immune evasion

  • Analysis of GPC evolution under immune pressure in natural settings

How can recombinant Mobala virus GPC be optimally utilized in serosurveillance studies?

Recombinant Mobala virus GPC represents a valuable tool for conducting serosurveillance studies in regions where the virus circulates. ELISA-based approaches using this recombinant protein can provide important epidemiological data:

  • Optimal assay design:

    • Use full-length recombinant GPC or specific domains (GP1/GP2) depending on the study goals

    • Implement proper negative and positive controls, including cross-reactive controls for other arenaviruses

    • Establish clear cutoff values based on confirmed negative populations

  • Application in field studies:

    • Previous studies have shown seroprevalence in humans ranging from 3.1% to 3.8% in villages with Mobala virus circulation

    • Correlation between rodent prevalence and human seroconversion suggests transmission dynamics that can be tracked using recombinant GPC-based assays

  • Cross-reactivity considerations:

    • Carefully validate assays to distinguish between antibodies targeting Mobala virus versus related arenaviruses

    • Consider using specific GP1 domains that contain unique epitopes for Mobala virus

  • Antibody functionality assessment:

    • Beyond simple binding assays, neutralization tests using pseudotyped viruses bearing Mobala virus GPC can assess functional immunity

    • Correlation between binding and neutralizing antibodies provides insights into protective immunity

What are the methodological challenges in producing functional recombinant Mobala virus GPC for research applications?

Producing functional recombinant Mobala virus GPC presents several technical challenges that must be addressed to ensure the protein retains its native conformation and biological activity:

  • Expression system selection:

    • Mammalian expression systems are preferred to ensure proper post-translational modifications, especially glycosylation

    • Insect cell systems may provide higher yield but with altered glycosylation patterns

    • Bacterial systems are generally unsuitable due to lack of glycosylation machinery

  • Proteolytic processing considerations:

    • Co-expression with S1P protease may be necessary to ensure proper cleavage of the GPC

    • Alternatively, designing constructs with engineered protease sites for in vitro processing

  • Protein stabilization strategies:

    • The pre-fusion conformation of GPC is metastable and may spontaneously convert to the post-fusion form

    • Stabilizing mutations or antibody binding may help maintain the desired conformation

    • Storage in glycerol-containing buffers (e.g., 50% glycerol) at -20°C helps maintain stability

  • Functional validation methods:

    • Binding assays to verify receptor interaction

    • Fusion assays to confirm functional activity

    • Antigenic profiling using antibodies against different conformational states

These methodological considerations are critical for ensuring that recombinant GPC preparations accurately represent the native viral protein for research applications.

What genomic approaches can advance our understanding of Mobala virus diversity and evolution in natural settings?

Advanced genomic approaches offer powerful tools for investigating Mobala virus diversity and evolution in its natural ecological context:

  • Metagenomic surveillance:

    • Deep sequencing of samples from Praomys rodents in endemic regions

    • Environmental sampling to detect viral RNA in rodent habitats

    • Using both short-read (Illumina) and long-read (MinION) technologies for comprehensive coverage

  • Bioinformatics classification tools:

    • Comparative analysis using tools like Kaiju, Centrifuge, and Kraken2 for taxonomic classification

    • Homology searching using BLASTN for novel variant identification

    • Mapping against reference sequences using tools like Minimap2

  • Phylogenomic analysis:

    • Construction of time-calibrated phylogenies to understand Mobala virus evolution

    • Molecular clock analyses to date divergence events, as was done for strain AnRB3214 which was estimated to have diverged from Mobala virus approximately 400 years ago

    • Selection pressure analysis to identify GPC domains under positive selection

  • Geographic information systems integration:

    • Mapping viral genetic diversity against ecological variables

    • Understanding geographic barriers to viral spread

    • Modeling potential range expansion with climate change

These genomic approaches would significantly advance our understanding of Mobala virus ecology and evolution, particularly regarding its GPC diversity.

How might structural knowledge of Mobala virus GPC inform development of broad-spectrum interventions against arenaviruses?

Detailed structural characterization of Mobala virus GPC could provide valuable insights for designing broad-spectrum antiviral strategies against arenaviruses:

  • Conserved epitope identification:

    • Structural comparison of GPCs across arenaviruses to identify conserved, functionally critical domains

    • Design of broadly neutralizing antibodies targeting these conserved regions

    • Development of antibody cocktails targeting multiple conserved epitopes

  • Entry inhibitor design:

    • Structure-based design of small molecules targeting the fusion mechanism

    • Peptide inhibitors mimicking critical regions involved in the fusion process

    • Compounds targeting the unique S1P cleavage site (RRLM in Mobala virus)

  • Receptor interaction blockade:

    • Detailed mapping of the receptor-binding interface

    • Development of receptor decoys or competitive inhibitors

    • Design of antibodies that block receptor engagement without inducing escape mutations

  • Novel vaccine strategies:

    • Structure-guided immunogen design focusing on conserved, neutralization-sensitive epitopes

    • Stabilized pre-fusion GPC constructs as potential vaccine candidates

    • Chimeric GPC constructs incorporating protective epitopes from multiple arenaviruses

These approaches, informed by structural insights from Mobala virus GPC, could contribute to the development of medical countermeasures not only for Mobala virus but potentially for more pathogenic arenaviruses like Lassa virus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.