Recombinant Mogera wogura NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Complex I

MT-ND4L is essential for electron transfer in the NADH-ubiquinone oxidoreductase complex, facilitating ATP synthesis via oxidative phosphorylation . Key functions include:

  • Electron Transport: Transfers electrons from NADH to ubiquinone, initiating the proton gradient across the inner mitochondrial membrane .

  • Complex Assembly: Interacts with subunits like ND3, ND4, and ND5 to form the 950-kDa Complex I structure . Disruption of MT-ND4L prevents proper complex assembly and activity .

Interaction Network
MT-ND4L partners with core Complex I subunits, as shown in STRING interaction networks :

PartnerRole in Complex IConfidence Score
ND3Core subunit for electron transfer0.999
ND4Membrane-embedded subunit0.999
ND5Core subunit for proton pumping0.999
NDUFS3Iron-sulfur cluster binding0.999

Link to Leber Hereditary Optic Neuropathy (LHON)

Mutations in MT-ND4L (e.g., Val65Ala) are linked to LHON, a mitochondrial disorder causing progressive vision loss . This mutation disrupts Complex I function, reducing ATP production and leading to optic nerve degeneration .

Drug Discovery Efforts

Receptor.AI has prioritized MT-ND4L as a therapeutic target, leveraging AI-driven conformational analysis to design small-molecule inhibitors . Key efforts include:

  • Focused Library Design: Compounds annotated with 38 ADME-Tox and 32 physicochemical parameters.

  • Structural Insights: Predicted alternative conformations for ligand binding, enabling targeted drug development .

Functional Impact of Mutations

Studies on ND4 gene mutations in multiple sclerosis (MS) patients identified deleterious variants (e.g., m.11150G>A, m.11519A>C) that destabilize ND4 protein stability and impair Complex I activity . While these mutations affect ND4 (not ND4L), they highlight the broader vulnerability of Complex I subunits to pathogenic variants .

Experimental Models

In Chlamydomonas reinhardtii, RNA interference (RNAi) silencing of nuclear-encoded NUO11 (ND4L homolog) abolishes Complex I assembly and activity, underscoring ND4L’s indispensable role .

Production and Handling

The recombinant protein is purified via His-tag affinity chromatography and lyophilized for storage . Critical handling guidelines include:

  • Storage: -20°C/-80°C, avoiding repeated freeze-thaw cycles.

  • Reconstitution: Use deionized water (0.1–1.0 mg/mL) with glycerol for stability .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. To minimize degradation, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Mogera wogura (Japanese mole) (Mogera kobeae)
Target Names
Target Protein Sequence
MSLVYMNIMIAFLTSLLGLLMYRSHLMSSLLCLEGMMLSLFILSTIMILNIHFTLASMIP IILLVFAACEAAIGLSLLVMVSNTYGVDYVQNLNLLQC
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes the transfer of electrons from NADH through the respiratory chain, using ubiquinone as the electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the MT-ND4L protein and what is its role in mitochondrial function?

MT-ND4L (NADH dehydrogenase subunit 4L) is a critical component of mitochondrial Complex I (NADH:ubiquinone oxidoreductase), which plays an essential role in the electron transport chain. This protein is encoded by the mitochondrial genome and functions within the inner mitochondrial membrane. MT-ND4L specifically contributes to the first step of electron transport, facilitating the transfer of electrons from NADH to ubiquinone during oxidative phosphorylation. This process creates an electrochemical gradient across the inner mitochondrial membrane that drives ATP production, the primary energy currency in cells . The protein's function is integral to cellular respiration and energy metabolism across species, including in the Japanese mole (Mogera wogura).

What are the common methods for expressing and purifying recombinant MT-ND4L?

Recombinant MT-ND4L can be expressed using several host systems, including E. coli, yeast, baculovirus, or mammalian cell expression platforms, with selection depending on experimental requirements and downstream applications . For purification, the following protocol is typically employed:

  • Cell lysis using appropriate buffers containing glycerol as a stabilizing agent

  • Initial purification via affinity chromatography (if tagged constructs are used)

  • Secondary purification through size exclusion or ion exchange chromatography

  • Quality assessment with SDS-PAGE to confirm >90% purity

  • Storage in glycerol-containing buffer at -20°C or -80°C for long-term preservation

To maintain protein stability and activity, it is crucial to avoid repeated freeze-thaw cycles, which can significantly reduce functional protein yield.

How can recombinant MT-ND4L be used to study mitochondrial Complex I assembly?

Researchers can employ recombinant MT-ND4L in several experimental approaches to investigate Complex I assembly:

  • Complementation studies: Introducing recombinant MT-ND4L into cells with mutated or deleted endogenous MT-ND4L to rescue Complex I assembly and function.

  • Protein-protein interaction analysis: Using tagged recombinant MT-ND4L with pull-down assays, co-immunoprecipitation, or crosslinking studies to identify interaction partners within Complex I.

  • In vitro reconstitution experiments: Combining recombinant MT-ND4L with other Complex I subunits to study step-by-step assembly processes in controlled conditions.

  • Structure-function analysis: Introducing site-directed mutations in recombinant MT-ND4L to identify critical residues for Complex I assembly.

These approaches are supported by evidence that the absence of MT-ND4L prevents Complex I assembly, confirming its essential structural role .

What controls should be included when working with recombinant MT-ND4L in enzyme activity assays?

When designing enzyme activity assays with recombinant MT-ND4L, researchers should incorporate the following controls:

  • Positive controls: Include commercially validated Complex I or NADH dehydrogenase preparations with known activity.

  • Negative controls: Use samples treated with known Complex I inhibitors such as rotenone or pyridaben to establish baseline inhibition profiles .

  • Vehicle controls: Include all buffer components and storage additives (like glycerol) to account for potential effects on enzyme kinetics.

  • Thermal stability controls: Assess activity across different temperature conditions to establish optimal assay parameters.

  • Species-specific comparative controls: Compare activity with MT-ND4L from other species to identify functional conservation or divergence.

These controls help ensure experimental validity and reproducibility when characterizing the enzymatic properties of recombinant MT-ND4L.

How do mutations in MT-ND4L contribute to neurodegenerative diseases?

Mutations in MT-ND4L have been implicated in several neurodegenerative conditions, with the following mechanisms:

  • Complex I dysfunction: Mutations can impair electron transport, reducing ATP production and increasing oxidative stress.

  • Leber hereditary optic neuropathy (LHON): The T10663C (Val65Ala) mutation in MT-ND4L has been identified in families with LHON, a condition characterized by sudden vision loss due to retinal ganglion cell degeneration .

  • Mitochondrial energy deficit: In neuronal cells, MT-ND4L mutations can lead to insufficient energy production, particularly affecting high-energy-demanding neurons.

  • Increased ROS production: Dysfunctional MT-ND4L can increase reactive oxygen species generation, contributing to neuronal damage.

The specific mechanisms connecting MT-ND4L mutations to neurodegeneration remain under investigation, but the protein's critical role in energy metabolism makes it a significant factor in diseases affecting tissues with high energy demands.

What is the relationship between MT-ND4L genetic variants and adaptation to high-altitude environments?

Research on MT-ND4L variants has revealed fascinating connections to high-altitude adaptation, particularly in studies of Tibetan yaks and cattle. Specific haplotypes of MT-ND4L, especially haplotype Ha1, show positive associations with high-altitude adaptability (p < .0017) . These adaptations likely involve:

  • Enhanced mitochondrial efficiency: Variants that improve oxygen utilization in low-oxygen environments.

  • Modified electron transport dynamics: Adaptations that maintain energy production under hypoxic conditions.

  • Altered Complex I assembly: Structural variations that optimize respiratory chain function at high altitudes.

Conversely, some haplotypes (Ha3) demonstrate negative associations with high-altitude adaptation . These findings suggest that MT-ND4L genetic diversity contributes to the remarkable ability of certain species to thrive in the challenging conditions of high-altitude environments, such as the Qinghai-Tibetan Plateau with altitudes ranging from 3000-5000m.

Can recombinant MT-ND4L be used as a therapeutic tool for Complex I deficiencies?

While direct application of recombinant MT-ND4L as a therapeutic remains challenging, research suggests promising approaches:

  • Gene therapy approaches: Similar to studies with the yeast NDI1 gene, which encodes a single-subunit NADH dehydrogenase that can functionally replace Complex I in mammalian cells .

  • Neuroprotective strategies: Recombinant versions could be used to develop protective interventions against Complex I inhibition, potentially relevant for Parkinson's disease and Huntington's disease.

  • Research tools for drug development: Recombinant MT-ND4L can serve as a target for screening compounds that might stabilize mutant forms or enhance residual Complex I activity.

Research has demonstrated that expression of alternative NADH dehydrogenases (like yeast Ndi1) in dopaminergic cell lines provides resistance against Complex I inhibitors such as rotenone and pyridaben, suggesting viable therapeutic strategies for addressing Complex I dysfunction .

How do post-translational modifications affect MT-ND4L function within Complex I?

Investigation of post-translational modifications (PTMs) of MT-ND4L represents an advanced research area with significant implications for understanding Complex I regulation:

  • Phosphorylation sites: Identification of potential phosphorylation targets that may regulate electron transfer efficiency or protein-protein interactions.

  • Oxidative modifications: Assessment of how oxidative stress-induced modifications affect MT-ND4L stability and function.

  • Conformational changes: Analysis of how PTMs might induce structural alterations that affect proton pumping efficiency.

  • Interaction with assembly factors: Investigation of how modifications influence interactions with Complex I assembly factors and chaperones.

Methodological approaches should include mass spectrometry-based PTM mapping, site-directed mutagenesis of modification sites, and functional assays comparing native and modified forms of the protein.

What are the species-specific variations in MT-ND4L and their functional implications?

SpeciesNotable MT-ND4L VariantsFunctional ImplicationsResearch Methods
Mogera wogura (Japanese mole)Unique hydrophobic domain variantsPotentially adapted for burrowing lifestyle with fluctuating oxygen levelsComparative genomics, recombinant protein studies
Tibetan yakHaplotype Ha1Positive association with high-altitude adaptation (p < .0017)SNP analysis, phenotypic correlation
Holstein-Friesian cattleHaplotype Ha3Negative association with high-altitude adaptationComparative genomics, physiological studies
Chlamydomonas reinhardtiiNucleus-encoded versionEssential for Complex I assemblyGenetic knockout studies, biochemical analysis
HumansT10663C (Val65Ala)Associated with Leber hereditary optic neuropathyClinical genetics, patient cohort studies

This comparative approach reveals how evolutionary pressures have shaped MT-ND4L across species, with variations that reflect adaptation to different environmental conditions and metabolic demands.

How does the interaction between nuclear and mitochondrial genetic systems regulate MT-ND4L expression and function?

The regulation of MT-ND4L involves complex interactions between nuclear and mitochondrial genomes:

  • Coordinated gene expression: Nuclear factors regulate mitochondrial transcription and translation machinery that processes MT-ND4L mRNA.

  • Assembly factors: Nuclear-encoded proteins assist in the incorporation of MT-ND4L into Complex I.

  • Quality control systems: Nuclear-encoded mitochondrial proteases and chaperones regulate MT-ND4L turnover and folding.

  • Mitochondrial dynamics: Nuclear genes controlling mitochondrial fusion, fission, and mitophagy affect the functional pool of MT-ND4L-containing complexes.

  • Retrograde signaling: Mitochondrial dysfunction involving MT-ND4L can trigger nuclear gene expression changes through retrograde signaling pathways.

Research in Chlamydomonas reinhardtii has shown that both nuclear and mitochondrially encoded subunits are essential for proper Complex I assembly, highlighting the critical nature of this genetic cooperation .

What are the optimal conditions for functional assays using recombinant MT-ND4L?

When designing functional assays with recombinant MT-ND4L, researchers should consider:

  • Buffer composition:

    • pH 7.2-7.5 phosphate or HEPES buffer

    • 150-200 mM NaCl for physiological ionic strength

    • 5-10% glycerol for protein stability

    • 1-2 mM DTT or β-mercaptoethanol to maintain reducing conditions

  • Temperature considerations:

    • Maintain assays at 25-30°C for optimal enzymatic activity

    • Pre-incubate components to ensure temperature equilibration

  • Substrate concentrations:

    • NADH: 50-200 μM

    • Ubiquinone (CoQ10): 50-100 μM

  • Detection methods:

    • Spectrophotometric assays tracking NADH oxidation at 340 nm

    • Oxygen consumption measurements using Clark-type electrodes

    • Membrane potential assays using potential-sensitive fluorescent dyes

  • Integration analysis:

    • Reconstitution into liposomes or nanodiscs for membrane protein functionality

    • Co-expression with other Complex I subunits for assembly studies

These conditions should be optimized based on the specific experimental objectives and the properties of the recombinant MT-ND4L preparation being used .

How can researchers effectively model MT-ND4L-related diseases in experimental systems?

Developing effective disease models for MT-ND4L-related conditions requires multifaceted approaches:

  • Cell-based models:

    • CRISPR/Cas9 introduction of disease-associated mutations (e.g., T10663C)

    • RNA interference to downregulate MT-ND4L expression

    • Cybrid cells containing patient-derived mitochondria with MT-ND4L mutations

  • Animal models:

    • Transgenic mice expressing mutant MT-ND4L

    • Conditional knockout systems using tissue-specific promoters

    • Environmental stress models that exacerbate MT-ND4L dysfunction

  • 3D tissue models:

    • Organoids derived from patient cells with MT-ND4L mutations

    • Neuron-glia co-cultures to study cell-type specific effects

  • Assessment parameters:

    • Mitochondrial respiration rates

    • ROS production measurements

    • ATP synthesis capacity

    • Cellular stress responses

    • Tissue-specific pathological changes

These models allow for the systematic study of how MT-ND4L mutations contribute to diseases like Leber hereditary optic neuropathy and potentially other neurodegenerative conditions .

What are the emerging techniques for studying MT-ND4L interactions within the mitochondrial membrane?

Cutting-edge approaches for investigating MT-ND4L membrane interactions include:

  • Cryo-electron microscopy: High-resolution structural analysis of MT-ND4L within intact Complex I in native membrane environments.

  • Single-molecule FRET: Measuring conformational changes and dynamic interactions between MT-ND4L and other Complex I subunits during the catalytic cycle.

  • Mass spectrometry-based crosslinking: Identifying precise interaction interfaces between MT-ND4L and neighboring proteins.

  • Nanoscale secondary ion mass spectrometry (NanoSIMS): Tracking isotopically labeled MT-ND4L to determine turnover rates and spatial distribution within mitochondria.

  • In-cell NMR: Characterizing MT-ND4L dynamics in living cells under various physiological conditions.

  • Computational molecular dynamics simulations: Predicting how MT-ND4L movements contribute to proton pumping and electron transfer.

These advanced techniques promise to reveal unprecedented details about how MT-ND4L functions within the mitochondrial membrane and contributes to Complex I activity.

How might MT-ND4L research contribute to developing mitochondrial replacement therapies?

Research on MT-ND4L has important implications for developing mitochondrial replacement therapies:

  • Single-subunit NADH dehydrogenase applications: Building on research showing that yeast Ndi1 can functionally replace Complex I in mammalian cells, providing resistance against Complex I inhibitors and potentially treating conditions associated with Complex I dysfunction .

  • Gene therapy approaches: Developing vectors capable of delivering functional MT-ND4L genes to affected tissues, particularly for treating conditions like Leber hereditary optic neuropathy.

  • Mitochondrial editing technologies: Adapting CRISPR-based approaches to target and correct mutations in mitochondrial DNA affecting MT-ND4L.

  • Protein replacement strategies: Developing methods to introduce recombinant MT-ND4L directly into mitochondria of affected cells.

  • Pharmacological chaperones: Identifying small molecules that can stabilize mutant MT-ND4L and restore proper folding and function.

These approaches could potentially address the underlying mitochondrial dysfunction in various diseases associated with MT-ND4L mutations or deficiencies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.