Recombinant Moloney murine leukemia virus Glycosylated Gag polyprotein (gag)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance (additional fees apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If a particular tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
gag; Glyco-Gag protein; Gross cell surface antigen; glycosylated Pr80 gag; gPr80 Gag; gag-gPr80
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
430-626
Protein Length
Full Length of Mature Protein
Species
Moloney murine leukemia virus (strain neuropathogenic variant ts1-92b) (MoMLV)
Target Names
gag
Target Protein Sequence
QNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETN VAMSFIWQSAPDIGRKLERLEDLKNKTLGDLVREAERIFNKRETPEEREERIRRETEEKE ERRRTEDEQKEKERDRRRHREMSKLLATVVSGQRQDRQGGERRRSQLDRDQCAYCKEKGH WAKDCPKKPRGPRGPRPQTSLLTLDD
Uniprot No.

Target Background

Function
Appears crucial for efficient in vivo replication.
Subcellular Location
[Nextended-MA-p12]: Host cell membrane; Single-pass type II membrane protein.; [CA-NC]: Secreted.

Q&A

What is the structural relationship between gPr80gag and the standard Gag polyprotein (Pr65gag)?

gPr80gag represents an extended form of the standard Gag polyprotein found in Moloney murine leukemia virus. It contains all the peptide sequences present in Pr65gag plus an additional 88 amino-terminal amino acids that include a signal peptide. This extended sequence directs the protein to the rough endoplasmic reticulum where it undergoes glycosylation before being exported to the cell surface . While Pr65gag is processed into the structural components of the viral capsid (matrix, p12, capsid, and nucleocapsid), gPr80gag follows a different cellular pathway. After reaching the cell surface, mature gPr80gag is cleaved into two proteins of approximately 55 kDa (N-terminal) and 40 kDa (C-terminal), with the 55 kDa portion maintained in a type II integral membrane configuration . This structural arrangement positions the unique 88 amino acids in the cytosol while the C-terminal portion faces extracellularly .

How is gPr80gag synthesized in infected cells?

The synthesis of gPr80gag follows a distinct translational pathway from that of Pr65gag. Both proteins are translated from the same unspliced viral mRNA but utilize different initiation codons. While Pr65gag translation begins at a conventional AUG initiation codon, gPr80gag translation initiates at an upstream CUG codon that is in-frame with the AUG used for Pr65gag . This alternative initiation mechanism results in the addition of the 88 amino-terminal residues that distinguish gPr80gag from Pr65gag. The signal peptide within these additional amino acids directs the nascent polypeptide to the rough endoplasmic reticulum where it undergoes glycosylation. Following glycosylation, the protein is transported through the secretory pathway to the cell surface, where it is cleaved into the two constituent proteins . This cellular trafficking pathway is entirely distinct from that of Pr65gag, which remains in the cytoplasm until it assembles at the plasma membrane for viral budding .

Why is gPr80gag evolutionarily conserved among gammaretroviruses?

The evolutionary conservation of gPr80gag among gammaretroviruses suggests it serves essential functions in the viral life cycle. Experimental evidence indicates that viruses lacking functional gPr80gag show replication defects in vivo, and there is strong selective pressure for the recovery of glyco-gag function during infection in mice . This conservation likely reflects the protein's multiple roles in facilitating viral replication and pathogenesis. gPr80gag has been demonstrated to enhance viral release from infected cells through lipid rafts, counteract restriction factors such as mouse APOBEC3, and potentially complement functions of HIV-1 Nef when expressed in HIV-1 virions . Additionally, gPr80gag serves as a major pathogenic determinant for neuropathic FrCasE MuLV . The conservation of this protein across different gammaretroviruses, despite the apparent viability of gPr80gag-deficient viruses in certain in vitro systems, highlights its importance for successful viral replication in the complex environment of a living host .

What experimental approaches can be used to generate and characterize gPr80gag-deficient M-MuLV mutants?

The generation of gPr80gag-deficient M-MuLV mutants can be accomplished through several molecular cloning strategies. One effective approach involves substituting the relevant genomic region of M-MuLV with corresponding segments from related viruses that naturally lack gPr80gag expression. For example, researchers have successfully constructed gPr80gag-deficient mutants by replacing specific fragments of the M-MuLV genome with sequences from Abelson MuLV (Ab-MuLV) or Moloney murine sarcoma virus (M-MSV) . Specifically, for Ab-MuLV-based mutations, a 177-base-pair PstI fragment containing the initiation codon for Pr65gag can be substituted. Alternatively, for M-MSV-based constructs, a larger 1.5 kilobase region at the 5' end of the genome can be replaced .

Characterization of these mutants should employ multiple complementary approaches. Viral protein expression can be assessed using immunoblotting with antibodies specific to both glycosylated and non-glycosylated Gag proteins. Virus production and infectivity can be quantified through titration assays on permissive cell lines, while replication kinetics can be monitored via multi-step growth curves. Plaque morphology in XC cells provides additional phenotypic information, as gPr80gag-deficient viruses show subtle differences in plaque appearance . For more comprehensive analysis, transfection of recombinant proviral DNA into cells (e.g., NIH-3T3) followed by passage of resulting viruses allows for assessment of viral fitness and potential reversion to wild-type phenotypes .

How does gPr80gag facilitate viral release through lipid rafts, and what methodologies can detect this interaction?

gPr80gag facilitates viral release by promoting the association of viral components with cholesterol-rich lipid rafts in the plasma membrane. This function can be demonstrated through several experimental approaches. First, the cholesterol content of virions can be quantified using enzymatic assays, which typically show that gPr80gag-positive viruses contain higher levels of cholesterol than their gPr80gag-negative counterparts . Second, the sensitivity of viral release to cholesterol-depleting agents such as methyl-β-cyclodextrin (MβCD) can be assessed; gPr80gag-positive viruses show greater sensitivity to MβCD treatment, confirming their dependence on cholesterol-rich domains for efficient budding .

To directly visualize the association of viral components with lipid rafts, detergent resistance assays can be employed. Cells infected with wild-type or gPr80gag-deficient viruses are lysed with cold non-ionic detergents (e.g., Triton X-100), and the lysates are fractionated by sucrose gradient centrifugation. Immunoblotting analysis of the resulting fractions reveals that Pr65gag from wild-type viruses predominantly associates with detergent-resistant membrane (DRM) fractions, while Pr65gag from gPr80gag-deficient viruses shows reduced DRM association . Additionally, the localization of viral proteins within the plasma membrane can be visualized using confocal microscopy with fluorescently-labeled antibodies against viral proteins and markers of lipid rafts, such as GM1 ganglioside or flotillin . These combined approaches provide robust evidence for the role of gPr80gag in facilitating virus release through lipid rafts.

What is the relationship between gPr80gag and interferon-mediated antiviral responses?

The relationship between gPr80gag and interferon-mediated antiviral responses represents a critical aspect of virus-host interactions. Research indicates that gPr80gag facilitates viral release along an interferon-sensitive pathway, suggesting it may counteract specific interferon-induced restriction factors . To investigate this relationship, researchers can employ several methodological approaches. Cell lines can be treated with various concentrations of type I interferons (IFN-α or IFN-β) before infection with wild-type or gPr80gag-deficient viruses. Virus production is then quantified by measuring reverse transcriptase activity in culture supernatants or through viral titration assays .

The specific interferon-stimulated genes (ISGs) involved in gPr80gag-mediated evasion can be identified through RNA interference screening. Cells are transfected with siRNA libraries targeting known ISGs, followed by infection with wild-type and gPr80gag-deficient viruses in the presence of interferon. ISGs whose knockdown specifically rescues the replication of gPr80gag-deficient viruses are candidates for restriction factors counteracted by gPr80gag . Additionally, protein-protein interaction studies using co-immunoprecipitation or yeast two-hybrid screens can identify direct interactions between gPr80gag and cellular factors involved in interferon signaling or effector functions. These approaches collectively enable the dissection of the complex relationship between gPr80gag and the interferon system, providing insights into viral immune evasion strategies .

How does gPr80gag antagonize APOBEC3 restriction factors, and how can this activity be experimentally assessed?

gPr80gag has been shown to antagonize the antiviral activity of mouse APOBEC3 (mA3), a cytidine deaminase that induces hypermutation in viral genomes. To experimentally assess this antagonism, researchers can employ several complementary approaches. First, the infectivity of wild-type and gPr80gag-deficient viruses can be compared in the presence of increasing amounts of mA3. Cells are co-transfected with proviral DNA and expression vectors for mA3, and the resulting viruses are used to infect target cells. The infectivity is quantified using reporter assays or by measuring viral DNA synthesis in target cells .

To directly assess the incorporation of mA3 into virions, viral particles from cells expressing both virus and mA3 can be purified by ultracentrifugation through sucrose cushions. The viral proteins and incorporated mA3 are then analyzed by immunoblotting using antibodies against viral Gag and mA3. Wild-type viruses typically show reduced incorporation of mA3 compared to gPr80gag-deficient viruses . The hypermutation activity of incorporated mA3 can be measured by sequencing viral DNA isolated from infected cells. The frequency of G-to-A mutations, characteristic of APOBEC3 activity, is typically higher in viruses lacking gPr80gag .

Additionally, the interaction between gPr80gag and APOBEC3 can be investigated using co-immunoprecipitation experiments. Cells expressing tagged versions of gPr80gag and APOBEC3 are lysed, and protein complexes are immunoprecipitated using antibodies against the tags. The presence of both proteins in the precipitated complexes indicates direct interaction, which may explain the mechanism of APOBEC3 antagonism by gPr80gag .

How can genetic footprinting be applied to characterize functional domains within gPr80gag?

Genetic footprinting represents a powerful approach for comprehensive functional characterization of viral proteins, including gPr80gag. This technique allows for the simultaneous generation and analysis of numerous mutations throughout a gene of interest. To apply genetic footprinting to gPr80gag, researchers would first create a library of insertion mutations throughout the relevant region of the viral genome using transposon-mediated mutagenesis . This library is then used to transfect permissive cells, allowing for the production of a diverse pool of mutant viruses. After several rounds of infection, viral DNA is recovered from infected cells, and the distribution of mutations is analyzed by PCR amplification and sequencing .

Regions that are essential for gPr80gag function become depleted of mutations after serial passage, creating "footprints" in the mutational landscape. These footprints identify functionally critical domains that cannot tolerate disruption without compromising viral fitness . For comprehensive analysis, the footprinting should cover both the unique N-terminal region specific to gPr80gag and the regions shared with Pr65gag. The resulting functional map can reveal both known and previously uncharacterized domains essential for gPr80gag activity .

To validate the footprinting results, selected mutants from the library can be individually reconstructed and characterized using conventional virological methods. These include analyses of protein expression, subcellular localization, virus production, and infectivity. For particularly interesting mutants, detailed studies can determine the precise stage of the viral life cycle affected by the mutation . This combined approach of high-throughput footprinting followed by targeted validation provides a comprehensive understanding of structure-function relationships within gPr80gag.

What purification strategies are most effective for isolating recombinant gPr80gag for biochemical studies?

Purification of recombinant gPr80gag for biochemical studies presents unique challenges due to its glycosylation, membrane association, and proteolytic processing. An effective purification strategy must address these characteristics while maintaining protein functionality. One promising approach involves expressing a tagged version of gPr80gag in mammalian expression systems such as HEK293T cells, which provide the appropriate cellular machinery for glycosylation and processing . The protein can be tagged at either the N- or C-terminus with affinity tags such as His6, FLAG, or Strep-tag II, although care must be taken to ensure the tag does not interfere with protein function.

For membrane-associated forms of gPr80gag, initial extraction requires careful solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin, which preserve protein structure and interactions better than more stringent detergents like SDS or Triton X-100 . Following solubilization, affinity chromatography using tag-specific resins provides the first purification step. For secreted forms of gPr80gag, the culture medium can be directly applied to affinity columns after clarification by centrifugation and filtration .

Further purification can be achieved using size exclusion chromatography to separate monomeric gPr80gag from aggregates and other contaminating proteins. For highly pure preparations, ion exchange chromatography can serve as an additional step. Throughout the purification process, the glycosylation status and integrity of gPr80gag should be monitored using immunoblotting with specific antibodies and lectin blotting to detect glycan modifications . This multi-step approach yields pure, functional gPr80gag suitable for biochemical and structural studies while maintaining its native post-translational modifications.

How can researchers distinguish between the effects of gPr80gag and Pr65gag in functional assays?

Distinguishing between the effects of gPr80gag and Pr65gag in functional assays requires careful experimental design due to their overlapping sequences. Several approaches can effectively separate their functions. First, researchers can utilize mutant viruses specifically deficient in gPr80gag but competent for Pr65gag expression. These can be constructed by mutating the CUG initiation codon for gPr80gag or by introducing mutations in the signal peptide that prevent proper processing of gPr80gag without affecting the Pr65gag reading frame . Alternatively, substituting portions of the M-MuLV genome with corresponding segments from viruses that naturally lack gPr80gag expression, such as certain strains of Ab-MuLV or M-MSV, provides another strategy for generating gPr80gag-deficient viruses .

Complementation assays offer another powerful approach. Cells infected with gPr80gag-deficient viruses can be transfected with expression vectors encoding only gPr80gag, allowing researchers to assess whether the provision of gPr80gag in trans restores specific phenotypes . For biochemical studies, differential labeling techniques can distinguish between the two proteins. For instance, radioactive pulse-chase experiments with [35S]-methionine followed by immunoprecipitation can track the synthesis and processing of both proteins over time, revealing their distinct cellular fates .

Finally, subcellular fractionation can separate the proteins based on their different localizations: gPr80gag associates with cellular membranes and the secretory pathway, while Pr65gag predominantly localizes to the cytoplasm and plasma membrane during assembly . By combining these approaches, researchers can confidently attribute specific functions to either gPr80gag or Pr65gag in various experimental settings.

What cell culture systems best model the in vivo functions of gPr80gag?

For more physiologically relevant models, primary mouse cells derived from relevant tissues should be considered. Since M-MuLV primarily infects hematopoietic cells in vivo, primary mouse splenocytes, thymocytes, or bone marrow-derived cells offer more authentic cellular environments for studying gPr80gag functions . These primary cells typically express the full complement of innate immune sensors and restriction factors that gPr80gag may counteract, including APOBEC3 proteins and interferon-stimulated genes .

To model the impact of immune responses, cells can be treated with interferons or other cytokines before or after infection. This approach helps reveal how gPr80gag functions under immune pressure, particularly its role in counteracting interferon-induced antiviral states . For studying cell-type specific effects, differentiated or polarized cells may be necessary. For instance, macrophages derived from bone marrow precursors or polarized T cell subsets may exhibit distinct interactions with wild-type versus gPr80gag-deficient viruses .

When investigating cross-species activities, such as gPr80gag's ability to facilitate HIV-1 release, appropriate human cell lines like HEK293T or Jurkat T cells should be employed . By selecting cell systems that reflect relevant physiological contexts, researchers can gain more accurate insights into the multifaceted functions of gPr80gag.

How do glycosylated Gag proteins vary across different gammaretroviruses, and what functional implications do these variations have?

Glycosylated Gag proteins show considerable variation across gammaretroviruses in terms of sequence, size, and glycosylation patterns, yet they maintain functional conservation. Comparative analysis reveals that while the presence of glyco-gag is a defining feature of many gammaretroviruses, the specific molecular details differ. For instance, some xenotropic murine leukemia viruses (X-MuLVs) and ecotropic MuLVs contain canonical glyco-gag sequences, while other X-MuLVs and all polytropic MuLVs lack them . The xenotropic murine leukemia virus-related virus (XMRV) notably lacks the classical gPr80gag sequence found in M-MuLV, suggesting alternative mechanisms may have evolved to fulfill similar functions .

To systematically compare glyco-gag variants, researchers can employ sequence alignment and phylogenetic analysis of the leader sequences and gag regions from different gammaretroviruses. These analyses can identify conserved motifs, particularly in the unique N-terminal region, which may indicate functionally important domains . Structural predictions of the different glyco-gag proteins can highlight conserved folding patterns despite sequence divergence, potentially revealing critical structural elements.

Functional comparisons require expressing glyco-gag variants from different viruses in the same cellular context and assessing their capabilities in various assays. These include lipid raft association, viral release efficiency, antagonism of APOBEC3 proteins, and complementation of gPr80gag-deficient M-MuLV . Chimeric constructs, where domains from different glyco-gag proteins are swapped, can identify which regions are responsible for specific functions. Such systematic comparisons provide insights into how these proteins have evolved diverse sequences while maintaining critical functions, illuminating both the core mechanisms of glyco-gag action and the adaptations that tailor each variant to its specific viral and host context .

Can M-MuLV gPr80gag complement the function of glyco-gag in other retroviruses, and how can this be experimentally assessed?

The ability of M-MuLV gPr80gag to complement functions in other retroviruses provides valuable insights into conserved mechanisms of viral replication and host interaction. Evidence suggests that M-MuLV gPr80gag can facilitate the release of HIV-1-based vector particles from human cells, indicating functional conservation across distantly related retroviruses . To systematically assess cross-complementation capabilities, researchers can design several experimental approaches.

First, production of heterologous viruses in the presence or absence of M-MuLV gPr80gag can be evaluated. Cells are co-transfected with proviral DNA of the target retrovirus (e.g., HIV-1 with Nef deleted, or glyco-gag-deficient gammaretroviruses) along with an expression vector for M-MuLV gPr80gag. Virus production is quantified by measuring viral proteins, RNA, or infectivity in the culture supernatant . The association of viral components with lipid rafts can be assessed using detergent resistance assays, comparing viruses produced with or without gPr80gag complementation .

For more detailed analysis, chimeric viruses can be constructed where the gPr80gag coding sequence from M-MuLV is inserted into the genome of another retrovirus. For example, XMRV encoding the M-MuLV leader sequence (MXMRV) demonstrates that M-MuLV glyco-gag can facilitate XMRV release and increase infectivity . The impact of gPr80gag on viral sensitivity to restriction factors can be tested by challenging complemented viruses with various antiviral proteins, such as APOBEC3 family members or tetherin .

Cell type-dependent effects should also be examined, as the complementation efficiency may vary across different cell lines depending on the expression of relevant host factors . These comprehensive approaches reveal both the breadth of gPr80gag's functional conservation across retroviruses and the specific mechanisms underlying this conservation, with implications for understanding fundamental aspects of retrovirus-host interactions.

What high-throughput screening methods can identify host factors that interact with gPr80gag?

Identifying host factors that interact with gPr80gag requires sophisticated high-throughput screening approaches that capture both stable and transient interactions in relevant cellular contexts. One powerful method is affinity purification coupled with mass spectrometry (AP-MS). For this approach, tagged versions of gPr80gag (using epitope tags such as FLAG, HA, or BioID) are expressed in target cells. After crosslinking to stabilize transient interactions, cellular lysates are subjected to affinity purification using tag-specific antibodies or matrices. The co-purified proteins are then identified by mass spectrometry, revealing the interactome of gPr80gag .

Yeast two-hybrid (Y2H) screening offers another high-throughput approach. The coding sequence for gPr80gag (or specific domains) is fused to a DNA-binding domain, while a library of host cDNAs is fused to an activation domain. Positive interactions reconstitute a functional transcription factor, activating reporter genes. This system can screen millions of potential interactions, though it may miss interactions requiring post-translational modifications or membrane contexts .

For more physiologically relevant screening, proximity-dependent labeling techniques such as BioID or APEX can be employed. These methods involve fusing gPr80gag to an enzyme that biotinylates nearby proteins when activated. After labeling, biotinylated proteins are purified with streptavidin and identified by mass spectrometry. This approach captures both stable and transient interactions in their native cellular environment and is particularly valuable for membrane-associated proteins like gPr80gag .

Functional genomic screens using CRISPR-Cas9 libraries can identify host factors involved in gPr80gag-mediated phenotypes. Cells are transduced with genome-wide sgRNA libraries, then challenged with wild-type or gPr80gag-deficient viruses. Genes whose knockout specifically affects wild-type virus but not gPr80gag-deficient virus are likely involved in gPr80gag functions . By integrating data from these complementary screening approaches, researchers can construct comprehensive interaction networks that illuminate the molecular mechanisms underlying gPr80gag's diverse functions.

How can advanced imaging techniques be applied to visualize gPr80gag trafficking and function in live cells?

Advanced imaging techniques offer powerful tools for visualizing gPr80gag trafficking and function in real-time within living cells. To track gPr80gag movement, fluorescent protein fusions represent a fundamental approach. The gPr80gag coding sequence can be fused to fluorescent proteins such as mEGFP or mCherry, with careful placement of the tag to minimize interference with protein function. These constructs enable real-time tracking of gPr80gag from synthesis through processing, trafficking, and eventual cell surface localization using confocal or total internal reflection fluorescence (TIRF) microscopy .

For higher spatial resolution, super-resolution microscopy techniques such as stimulated emission depletion (STED), structured illumination microscopy (SIM), or photoactivated localization microscopy (PALM) can be employed. These approaches overcome the diffraction limit of conventional microscopy, allowing visualization of gPr80gag distribution within subcellular compartments and its association with specific membrane microdomains like lipid rafts .

To examine the dynamics of gPr80gag interactions with host factors, Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) can be utilized. These techniques detect protein-protein interactions in living cells, revealing both the spatial and temporal aspects of gPr80gag engagement with cellular proteins . For investigating the relationship between gPr80gag and lipid rafts, fluorescent lipid analogs or lipid-binding domains fused to fluorescent proteins can label these microdomains, allowing co-localization analysis with tagged gPr80gag .

Multi-color live-cell imaging enables simultaneous tracking of gPr80gag, standard Gag proteins, and cellular markers, providing comprehensive views of viral assembly and release processes. Correlative light and electron microscopy (CLEM) combines the specificity of fluorescence microscopy with the ultrastructural detail of electron microscopy, offering unique insights into gPr80gag localization at the nanoscale level . These advanced imaging approaches collectively provide unprecedented views of gPr80gag dynamics and interactions within the complex cellular environment, connecting molecular mechanisms to visible cellular processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.