Recombinant Molybdenum transport system permease protein modB (modB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery time information, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
modB; BQ2027_MB1889; Molybdenum transport system permease protein ModB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
modB
Target Protein Sequence
MHPPTDLPRWVYLPAIAGIVFVAMPLVAIAIRVDWPRFWALITTPSSQTALLLSVKTAAA STVLCVLLGVPMALVLARSRGRLVRSLRPLILLPLVLPPVVGGIALLYAFGRLGLIGRYL EAAGISIAFSTAAVVLAQTFVSLPYLVISLEGAARTAGADYEVVAATLGARPGTVWWRVT LPLLLPGVVSGSVLAFARSLGEFGATLTFAGSRQGVTRTLPLEIYLQRVTDPDAAVALSL LLVVVAALVVLGVGARTPIGTDTR
Uniprot No.

Target Background

Function
This protein is a component of the ModABCD binding-protein-dependent transport system for molybdenum. It likely plays a role in translocating the substrate across the membrane.
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ModB and what role does it play in molybdate transport?

ModB serves as the permease component of the ModBC-A transport system, an ATP-binding cassette (ABC) transporter that facilitates the uptake of molybdate across the bacterial cell membrane. As the transmembrane domain of this transporter complex, ModB forms the channel through which molybdate ions move from the extracellular environment into the cytoplasm . This transport process is energized by ATP hydrolysis, which causes conformational changes in the transmembrane helices of ModB to create a pathway for substrate translocation . The ModBC-A system represents one of multiple parallel transport systems that bacteria employ for molybdate uptake, highlighting the importance of this essential nutrient for various metabolic processes .

How does the ModBC-A transport system interact with parallel transport systems?

Research demonstrates that bacteria often employ multiple transporters for the same substrate to optimize nutrient acquisition under varying environmental conditions. The ModBC-A and MolBC-A systems function in parallel, allowing bacteria to take up greater amounts of molybdate than would be possible with a single transport system . This redundancy in transport mechanisms enables bacteria to adapt to fluctuating molybdate concentrations in their environment. Studies have shown that strains possessing both ModBC-A and MolBC-A systems can take up significantly more molybdate than strains with ModBC-A alone, particularly during periods of high external molybdate concentration . This strategic deployment of parallel transport systems represents an adaptive mechanism that enhances bacterial survival in diverse ecological niches.

What techniques are commonly used to study ModB structure and function?

Several sophisticated techniques are employed to investigate ModB structure and function in a lipid environment. Continuous wave-electron paramagnetic resonance (CW-EPR) spectroscopy has emerged as a particularly valuable tool for examining how the transmembrane helices of ModB reposition themselves in response to nucleotide binding and hydrolysis . This technique provides detailed insights into the conformational changes that drive substrate transport. Researchers also conduct substrate uptake studies to directly measure molybdate transport in vivo, often using radioactive tracers to quantify uptake rates under different conditions . Additionally, proteoliposome reconstitution systems allow for the study of purified ModB in a controlled lipid environment, enabling researchers to investigate how membrane composition affects transporter function and mechanism .

What experimental design considerations are critical when studying ModB in different membrane environments?

When designing experiments to study ModB function across different membrane environments, researchers must carefully consider several variables to ensure valid and reproducible results. First, the composition of the lipid environment is critical, as it significantly affects the flexibility and function of the transmembrane domains . Experiments should systematically vary lipid compositions to determine how different membrane properties influence ModB conformational changes and transport activity. Second, researchers must control for the presence of other transporters that might contribute to molybdate uptake, particularly when conducting in vivo studies .

How can researchers address contradictions in ModB functional studies across different experimental systems?

Contradictions in ModB functional studies often arise from differences in experimental systems, conditions, and methodologies. To address these contradictions systematically, researchers should implement a clinical contradiction detection approach similar to those used in medical literature analysis . This involves identifying paired statements about ModB function that appear to conflict, then carefully analyzing the experimental contexts in which these observations were made.

Researchers should categorize potential contradictions based on whether they stem from differences in experimental conditions, interpretation of results, or actual biological variations . For example, apparent contradictions in ModB transport rates might be explained by differences in membrane composition between studies, variations in the coupling between ATP hydrolysis and substrate translocation, or the presence of regulatory factors in one experimental system but not another . A systematic approach to contradiction analysis requires creating datasets of potentially contradictory findings and using ontology-driven methodologies to identify patterns and resolutions . When manually evaluating contradictions, researchers should pay particular attention to "hard" contradictions that are not simply based on the presence of negations in different papers but reflect genuine discrepancies in experimental outcomes .

What methodological approaches enable accurate characterization of ModB conformational changes during transport cycles?

Accurate characterization of ModB conformational changes during transport cycles requires sophisticated methodological approaches that capture the dynamic nature of the protein in a lipid environment. CW-EPR spectroscopy with site-directed spin labeling represents a powerful technique for monitoring specific regions of ModB as they undergo conformational changes during the transport cycle . This approach involves introducing spin labels at strategic positions within the transmembrane helices and measuring changes in mobility and accessibility in response to nucleotide binding and hydrolysis.

To ensure comprehensive data, researchers should:

  • Target multiple positions within the translocation pathway to map the complete conformational landscape

  • Compare measurements in detergent versus lipid environments to assess the impact of membrane constraints on protein dynamics

  • Correlate spectroscopic data with functional assays to link specific conformational states with transport activity

Additionally, researchers might employ complementary techniques such as hydrogen-deuterium exchange mass spectrometry or fluorescence resonance energy transfer (FRET) to obtain multi-parameter views of ModB dynamics. These approaches can reveal how the restricted flexibility observed in lipid environments affects the coupling between ATP hydrolysis and substrate translocation, providing mechanistic insights into how ModB functions within the complete ModBC-A transport system .

How can structural models and aggregation predictions inform ModB functional studies?

When utilizing structural predictions to inform ModB studies, researchers should integrate aggregation prediction tools like those in the A3D Database to identify potential structural aggregation prone regions (STAPs) that might affect ModB stability and function in different environments . This is particularly important when working with recombinant ModB, where protein aggregation can significantly impact experimental outcomes. Researchers should consider the following methodological approach:

  • Analyze predicted ModB structures to identify regions prone to aggregation

  • Validate structural predictions through experimental techniques like limited proteolysis or crosslinking

  • Correlate structural features with transport function through site-directed mutagenesis of key residues

  • Assess model confidence metrics (such as pLDDT scores from AlphaFold) when interpreting structural data

By combining structural predictions with experimental validation, researchers can develop more accurate models of how ModB undergoes conformational changes during the transport cycle and how these changes are influenced by the surrounding lipid environment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.