Recombinant Moorella thermoacetica NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparations.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Moth_0977; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Target Names
nuoA
Target Protein Sequence
MVLQQYGIIAVFLVGGAATAVAALATNWLLRPKKPPEGDKLAAYECGLKTQGPTWIQFKV SYFLYALVFLLFDVETVFLYPWAVRFQALGLFAFAEMIVFIGILVLGLWYAWKEGALKWL
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, the primary electron acceptor is believed to be a menaquinone. This redox reaction is coupled with proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological role of NADH-quinone oxidoreductase in Moorella thermoacetica?

NADH-quinone oxidoreductase (NDH-1) in Moorella thermoacetica functions as a proton-translocating enzyme that catalyzes the reduction of quinone using NADH as an electron donor. This process is coupled to the translocation of protons across the bacterial cytoplasmic membrane, contributing to energy conservation in this acetogenic bacterium . Unlike typical aerobic organisms, M. thermoacetica has unique metabolic adaptations as a thermophilic acetogen, including atypical one-carbon metabolism that affects its energy generation processes . The NDH-1 complex represents an essential component of the respiratory chain, forming part of the electron transport machinery that ultimately supports the organism's unique thermophilic acetogenic lifestyle.

How is the NADH-quinone oxidoreductase complex structured in prokaryotes like M. thermoacetica?

The prokaryotic NADH-quinone oxidoreductase (NDH-1) is an L-shaped membrane-bound enzyme complex consisting of 14 distinct subunits, designated NuoA through NuoN (or Nqo1-Nqo14 in some nomenclature systems) . The enzyme is organized into two functional domains:

  • The membrane arm: Composed of subunits NuoA, NuoH, NuoJ, NuoK, NuoL, NuoM, and NuoN, which are embedded in the cytoplasmic membrane and are involved in proton translocation .

  • The peripheral arm: Contains subunits NuoB, NuoC, NuoD, NuoE, NuoF, NuoG, and NuoI, which extend into the cytoplasm and house all the redox components including flavin mononucleotide (FMN) and 8-9 iron-sulfur clusters .

NuoA, specifically, resides within the membrane arm and contributes to the structural integrity and proton translocation function of the complex, though it does not directly participate in electron transfer.

What regulatory guidelines apply when working with recombinant forms of M. thermoacetica nuoA?

Research involving recombinant forms of M. thermoacetica nuoA is subject to the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules . These guidelines specify proper biosafety practices for constructing and handling:

  • Recombinant nucleic acid molecules

  • Synthetic nucleic acid molecules that can base pair with naturally occurring nucleic acids

  • Cells, organisms, and viruses containing such molecules

Institutions receiving NIH funding for any research involving recombinant or synthetic nucleic acids must comply with these guidelines unless specifically exempted . All recombinant DNA protocols must undergo review by an Institutional Biosafety Committee (IBC), and researchers must implement appropriate biosafety containment measures regardless of whether the recombinant components were generated through traditional recombinant DNA technology or synthetic techniques .

What expression systems are most effective for producing recombinant M. thermoacetica nuoA?

When expressing recombinant M. thermoacetica nuoA, researchers should consider the following expression systems based on the thermophilic nature of the source organism and the membrane-bound characteristics of the protein:

Expression SystemAdvantagesChallengesSpecial Considerations
E. coliHigh yield, well-established protocols, economicalPotential misfolding of thermophilic proteins, membrane integration issuesUse specialized strains like C41(DE3) or C43(DE3) designed for membrane proteins; consider fusion tags like MBP for solubility enhancement
Thermophilic hosts (T. thermophilus)Native-like temperature conditions, proper folding machineryLower yields, fewer genetic tools availableRequires specialized growth media and equipment for high-temperature cultivation
Cell-free systemsAvoids toxicity issues, direct access to reaction conditionsExpensive, limited scaleSupplementation with specific lipids may improve membrane protein folding

The expression vector design should incorporate appropriate temperature-inducible promoters, codon optimization for the host organism, and fusion tags that facilitate membrane protein expression and subsequent purification. For membrane integration studies, expression constructs that preserve the native membrane-spanning domains of nuoA are essential for maintaining proper structure and function.

How can researchers effectively verify the proper assembly of recombinant nuoA into the NDH-1 complex?

Verification of proper nuoA integration into the NDH-1 complex requires a multi-faceted approach:

  • Blue-native gel electrophoresis: This technique allows visualization of intact protein complexes and can confirm whether nuoA has been incorporated into the complete NDH-1 complex or sub-complexes . The pattern of bands observed can be compared to wild-type NDH-1 complex assembly.

  • Immunochemical analysis: Using antibodies specific to different NDH-1 subunits to detect the presence of nuoA and its interaction partners. Co-immunoprecipitation experiments can reveal direct interaction partners of nuoA within the complex .

  • Enzymatic activity assays: Measuring NADH oxidase or NADH:quinone oxidoreductase activities to assess functional complex assembly. The successful incorporation of nuoA should support wild-type or near wild-type levels of electron transfer activity .

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry analysis can identify spatial relationships between nuoA and neighboring subunits, confirming proper positioning within the complex.

  • Cryo-EM structural analysis: For advanced researchers, cryo-electron microscopy can provide structural evidence of nuoA incorporation into the L-shaped NDH-1 complex.

The absence of proper complex assembly may indicate issues with the recombinant nuoA construct or expression conditions that require optimization.

What site-directed mutagenesis strategies should be employed to study functional residues in M. thermoacetica nuoA?

Based on the structure-function relationships observed in NDH-1 complexes, a systematic site-directed mutagenesis approach for nuoA should target:

  • Conserved charged residues: As demonstrated for NuoC, charged residues (particularly Glu and Asp) can be critical for enzyme assembly and function . Identify conserved charged residues in nuoA through multiple sequence alignments and create charge-reversal or charge-neutralization mutations.

  • Membrane-spanning regions: Create scanning mutations across predicted transmembrane helices to identify regions essential for membrane integration and proton translocation.

  • Interface residues: Target amino acids predicted to form interfaces with other subunits (particularly those interfacing with NuoH and other membrane domain subunits) .

  • Chromosomal gene manipulation: Employ techniques similar to those used for NuoC studies, where chromosomal gene manipulation allowed for stable expression of mutant proteins in their native context .

To assess the impact of mutations, implement a tiered analysis approach:

  • Primary screening: Enzymatic assays for NADH oxidase activity

  • Secondary analysis: Blue-native gel electrophoresis to assess complex assembly

  • Tertiary analysis: Immunochemical studies to determine subunit stability and interactions

How do the structural and functional properties of M. thermoacetica nuoA differ from those of mesophilic bacteria?

M. thermoacetica nuoA exhibits specialized adaptations reflecting its thermophilic nature compared to mesophilic counterparts:

PropertyM. thermoacetica nuoA (Thermophilic)Mesophilic Bacterial nuoAFunctional Significance
Amino acid compositionHigher proportion of charged residues; increased Glu/Asp content in stabilizing positionsLower proportion of charged residuesEnhanced ionic interactions that maintain structural integrity at elevated temperatures
Membrane interactionModified hydrophobic domains optimized for reduced membrane fluidity at high temperaturesStandard hydrophobic domainsMaintains proper membrane anchoring in thermophilic environments
Protein-protein interactionsMore rigid interface regions with neighboring subunitsMore flexible interface regionsPrevents complex dissociation at elevated temperatures
Stability determinantsPotentially contains additional salt bridges and hydrogen bonding networksFewer stabilizing interactionsConfers thermostability while maintaining necessary flexibility for function

These differences necessitate specific considerations when expressing recombinant M. thermoacetica nuoA in mesophilic hosts, as the protein may require conditions that mimic its native environment for proper folding and function. Researchers should consider incorporating temperature steps in purification protocols and including stabilizing agents that preserve the protein's native thermophilic properties.

What are the critical experimental controls needed when studying interactions between recombinant nuoA and other NDH-1 subunits?

When investigating interactions between recombinant nuoA and other NDH-1 subunits, implement these essential controls:

  • Expression level normalization: Ensure comparable expression levels of wild-type and mutant nuoA to avoid artifacts from overexpression or inadequate expression.

  • Membrane fraction controls: Include proper subcellular fractionation controls to verify that recombinant nuoA localizes to membrane fractions similarly to native nuoA.

  • Non-interacting protein controls: Include an unrelated membrane protein subjected to identical experimental conditions to identify non-specific interactions.

  • Domain swap experiments: Create chimeric constructs swapping domains between nuoA from M. thermoacetica and a well-characterized mesophilic homolog to identify species-specific interaction determinants.

  • Assembly intermediate analysis: Isolate and characterize assembly intermediates of the NDH-1 complex to determine the stage at which nuoA incorporation occurs. This approach has proven valuable in mitochondrial complex I studies, where subcomplexes containing specific subunits have been identified during biogenesis .

  • Complementation controls: Test whether the recombinant nuoA can functionally complement nuoA-deficient strains, restoring NDH-1 activity and complex assembly.

These controls help distinguish between authentic biological interactions and experimental artifacts, particularly important when working with membrane proteins that may aggregate or misfold when expressed recombinantly.

How can researchers address challenges in purifying intact NDH-1 complex containing recombinant nuoA?

Purification of intact NDH-1 complex containing recombinant nuoA presents several challenges that can be addressed through specialized approaches:

  • Detergent optimization: Test a panel of mild non-ionic detergents (DDM, digitonin, LMNG) at varying concentrations to identify optimal solubilization conditions that maintain complex integrity. Begin with systematic detergent screening using small-scale preparations before scaling up.

  • Lipid supplementation: Include specific lipids during purification that stabilize the membrane domain. For thermophilic organisms like M. thermoacetica, consider lipids with higher saturation levels that mimic the native membrane environment at elevated temperatures.

  • Affinity tag placement: When incorporating affinity tags into recombinant nuoA, position them at termini predicted to face the cytoplasm rather than within membrane-spanning regions or at interfaces with other subunits. Consider using cleavable tags to minimize interference with complex assembly.

  • Temperature-controlled purification: Maintain samples at temperatures that balance protein stability with detergent solubility. For thermophilic proteins, room temperature purification may be preferable to traditional cold-room procedures.

  • Stabilizing agents: Include osmolytes like glycerol, sucrose, or specific ions that have been shown to stabilize protein complexes from thermophiles.

  • Gradient purification: Implement sucrose or glycerol gradient centrifugation steps to separate fully assembled complexes from assembly intermediates or dissociated subunits.

  • Rapid analysis techniques: Employ methods like blue-native PAGE to quickly assess complex integrity throughout the purification process, allowing for immediate optimization of conditions .

The success criteria should include both structural integrity (verified by native gel electrophoresis and electron microscopy) and functional activity (measured through NADH oxidase assays with appropriate electron acceptors).

What analytical approaches best characterize the impact of nuoA mutations on proton translocation?

Characterizing the impact of nuoA mutations on proton translocation requires sophisticated biophysical and biochemical approaches:

Data analysis should incorporate multiple parameters including:

  • Initial rates of proton translocation

  • Maximum pH gradient formed

  • Stability of the generated pH gradient

  • Correlation between electron transfer rates and proton translocation rates

These measurements should be compared against appropriate controls including ionophore-treated samples to establish baseline measurements for uncoupled systems.

How can researchers effectively compare nuoA function across different species of acetogenic bacteria?

To effectively compare nuoA function across different acetogenic bacteria:

  • Phylogenetic analysis framework: Construct comprehensive phylogenetic trees of nuoA sequences from diverse acetogens, categorizing them by metabolic capabilities (e.g., H2/CO2 utilization, one-carbon metabolism patterns) .

  • Heterologous expression system standardization: Develop a standardized heterologous expression system where nuoA variants from different species can be expressed under identical conditions, eliminating variables associated with different native backgrounds.

  • Structural homology modeling: Create structural models of nuoA variants based on available NDH-1 structures (e.g., from T. thermophilus) , identifying conserved and divergent features that may correlate with functional differences.

  • Chimeric protein analysis: Generate chimeric proteins containing domains from nuoA of different species to map functional domains specific to particular metabolic capabilities.

  • In vivo complementation assays: Test the ability of nuoA from different species to functionally complement nuoA-deficient strains of a model organism under standardized growth conditions.

  • Correlation with metabolic capabilities: Analyze how specific sequence features of nuoA correlate with the unique metabolic capabilities of different acetogens, such as the atypical one-carbon metabolism observed in M. thermoacetica strain AMP .

  • Co-evolution analysis: Examine co-evolutionary patterns between nuoA and other NDH-1 subunits across acetogenic species to identify interdependent adaptations that maintain complex functionality.

A comprehensive analysis should be presented in a comparative table highlighting species-specific nuoA features and correlating them with known metabolic properties of the source organisms.

What computational approaches can predict the impact of nuoA mutations on NDH-1 complex stability?

Advanced computational approaches to predict the impact of nuoA mutations include:

  • Molecular dynamics simulations: Perform extended simulations of wild-type and mutant nuoA within membrane environments, focusing on:

    • Local stability of the mutated region

    • Effects on protein-protein interfaces

    • Changes in membrane interaction profiles

    • Alterations in dynamical properties relevant to function

  • Free energy calculations: Implement free energy perturbation or thermodynamic integration methods to quantify the energetic impact of mutations on protein stability and subunit interactions.

  • Evolutionary coupling analysis: Apply direct coupling analysis (DCA) or related methods to large alignments of nuoA sequences to identify co-evolving residue pairs that maintain structural integrity. Mutations disrupting these pairs likely impact complex stability.

  • Network analysis of protein structure: Model the NDH-1 complex as a network where amino acids are nodes and interactions are edges. Analyze how mutations affect critical nodes in this network, particularly focusing on conserved charged residues similar to those identified in NuoC (Glu-138, Glu-140, and Asp-143) .

  • Machine learning approaches: Apply supervised learning algorithms trained on datasets of characterized mutations in membrane proteins to predict the impact of novel nuoA mutations.

  • Integration with experimental data: Calibrate computational predictions using experimental data from blue-native gel electrophoresis and immunochemical analyses of complex assembly for a subset of mutations .

This multi-scale modeling approach can provide mechanistic insights into how specific nuoA mutations affect complex assembly and stability, guiding experimental design and interpretation.

What emerging technologies could advance our understanding of M. thermoacetica nuoA structure-function relationships?

Several cutting-edge technologies hold promise for deeper insights into nuoA function:

  • Cryo-electron tomography: This technique can reveal the structure of NDH-1 complexes containing nuoA directly within native or reconstituted membranes, providing insights into the natural arrangement and interactions of the complex.

  • Single-molecule FRET: By strategically placing fluorophores on nuoA and interacting subunits, researchers can track conformational changes and subunit interactions during electron transfer and proton translocation in real-time.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can map dynamic regions and interfaces in nuoA under different functional states, revealing which regions undergo conformational changes during catalysis.

  • In-cell NMR: Developing methods to perform NMR studies in intact cells could provide structural information about nuoA in its native environment without extraction and purification.

  • AlphaFold2 and integrative structural modeling: Combining AI-predicted structures with sparse experimental constraints could generate more accurate models of nuoA and its interactions within the complete NDH-1 complex.

  • Genome-wide CRISPR screening: Identifying genetic interactions with nuoA could reveal unexpected functional relationships and regulatory networks affecting NDH-1 function in M. thermoacetica.

  • Time-resolved serial crystallography: This could potentially capture different conformational states of NDH-1 during the catalytic cycle, providing insights into how nuoA participates in energy transduction.

The integration of these technologies with traditional biochemical approaches would provide unprecedented resolution of nuoA's role in M. thermoacetica energy metabolism.

How might understanding nuoA function contribute to broader questions about acetogen evolution and metabolism?

Understanding nuoA function may illuminate several fundamental questions in acetogen biology:

  • Metabolic adaptation mechanisms: Detailed knowledge of nuoA function could explain how acetogens like M. thermoacetica have adapted their energy conservation mechanisms to support growth under thermophilic conditions and with atypical one-carbon metabolism .

  • Evolutionary trajectory of energy conservation: Comparative analysis of nuoA across acetogens could reveal the evolutionary path of respiratory complexes in these organisms, particularly how they adapted to different environmental niches and metabolic strategies.

  • Metabolic flexibility determinants: The unique one-carbon metabolism of M. thermoacetica strain AMP, including its inability to use H2/CO2 (unlike canonical M. thermoacetica strains), might be linked to adaptations in its respiratory chain including nuoA .

  • Co-factor dependence mechanisms: Insights from nuoA function could help explain phenomena like the cobalt-dependence observed in M. thermoacetica strain AMP's metabolism , potentially revealing how respiratory complexes adapt to micronutrient availability.

  • Inter-species metabolic cooperation: Understanding how nuoA contributes to energy conservation could explain the basis for syntrophic relationships observed between M. thermoacetica and hydrogen-consuming methanogens .

  • Thermophilic adaptation of membrane proteins: Structural and functional studies of nuoA from thermophilic M. thermoacetica may reveal general principles of how membrane proteins adapt to function at elevated temperatures.

These insights could ultimately contribute to broader ecological and evolutionary models of acetogen distribution and function in natural environments.

What are the most significant unresolved questions regarding M. thermoacetica nuoA function?

Despite advances in understanding NDH-1 complex structure and function, several critical questions about M. thermoacetica nuoA remain unresolved:

  • The precise contribution of nuoA to proton translocation pathways within the NDH-1 complex.

  • The structural adaptations that allow nuoA to function in a thermophilic environment compared to mesophilic homologs.

  • The role of nuoA in supporting M. thermoacetica's unusual metabolic flexibility, particularly its acetogenic metabolism under anaerobic conditions.

  • The specific protein-protein interactions between nuoA and other NDH-1 subunits that are critical for complex assembly and stability.

  • Whether nuoA contains specific functional motifs that contribute to the unique energetic requirements of acetogenic bacteria.

  • How the sequence and structural features of nuoA have evolved among different clades of acetogens to support diverse metabolic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.