Recombinant Moorella thermoacetica Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant CrcB2 is synthesized in Escherichia coli expression systems, followed by affinity chromatography using the His tag .

ParameterSpecification
Expression HostE. coli
TagHis tag
Purity≥85% (SDS-PAGE) ; ≥90% (commercial sources)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) for long-term storage
Storage-20°C/-80°C; working aliquots stable at 4°C for ≤1 week

Homology and Comparative Analysis

CrcB homologs are conserved across bacterial species, with functional roles in stress resistance (e.g., camphor resistance) or chromosome condensation .

SpeciesGene NameProtein FunctionUniProt ID
Moorella thermoaceticacrcB2Putative fluoride ion transporterQ2RL34
Bacillus cereuscrcB2Fluoride ion transporterQ631P3
Listeria monocytogeneslmo2082Camphor resistance proteinN/A
Staphylococcus aureuscrcB2Chromosome condensation proteinN/A

Research Applications

  • Metabolic Engineering: M. thermoacetica is a model organism for C1 gas conversion; CrcB2 may play a role in ion homeostasis during autotrophic growth .

  • Structural Studies: Used in crystallography or NMR to resolve ion transport mechanisms .

  • Biotechnological Tools: Serves as a reference protein in ELISA and immunoblotting .

Key Research Findings

  • Genetic Context: The crcB2 gene is part of a conserved genomic region in M. thermoacetica, adjacent to genes involved in stress response .

  • Electron Transport Linkage: Though not directly linked to the Wood-Ljungdahl pathway, M. thermoacetica’s energy metabolism involves electron-bifurcating enzymes like NfnAB, which could interact with membrane proteins like CrcB2 .

  • Functional Uncertainty: Despite homology to fluoride transporters, experimental validation of CrcB2’s role in M. thermoacetica is pending .

Future Directions

  • Functional Assays: Determine substrate specificity (e.g., fluoride ions) via knockout studies .

  • Interaction Mapping: Identify binding partners in M. thermoacetica’s membrane proteome .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
crcB2; Moth_0525; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Target Names
crcB2
Target Protein Sequence
MAWLYVGCGGIAGTLARFLLSRWLGNRVRGTWPLGTLFVNLSGAFLLGLLLALPQGRLPA NVTLALGTGFVGAYTTFSTFTYETVTMIGDGEGKRALAYSLGSILGGLLLAWLGWLAAGS LF
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CrcB homolog 2 (crcB2) and how does it differ from CrcB homolog 1 (crcB1)?

CrcB homolog 2 (crcB2) is a protein involved in fluoride ion transport and resistance mechanisms in bacteria, including Moorella thermoacetica. It functions as an anion channel that specifically exports fluoride ions from the cytoplasm, thereby preventing toxic accumulation. While both crcB1 and crcB2 contribute to fluoride resistance, they may have distinct expression patterns, structural differences, or functional specializations within the same organism. In some bacterial species like Streptococcus sanguinis, both crcB1 and crcB2 work synergistically to achieve optimal fluoride resistance .

What is the evolutionary significance of CrcB proteins in bacteria?

CrcB proteins represent an evolutionarily conserved mechanism for fluoride resistance across diverse bacterial species. Their presence in thermophilic bacteria like Moorella thermoacetica suggests an adaptation to environments where fluoride exposure may be encountered. Different bacterial groups have evolved varying strategies for fluoride resistance: some rely exclusively on EriC proteins, others utilize both EriC and CrcB proteins, and some depend primarily on CrcB proteins. This evolutionary divergence in fluoride resistance mechanisms demonstrates adaptation to specific ecological niches and environmental pressures .

How does the structure of CrcB2 relate to its function?

CrcB2 functions as a transmembrane anion channel specifically adapted for fluoride transport. The protein likely forms multimeric complexes within the cell membrane to create a selective pore for fluoride ions. Key structural features include hydrophobic transmembrane domains that anchor the protein in the membrane and charged residues that facilitate ion selectivity and movement. While the specific structure of Moorella thermoacetica CrcB2 hasn't been fully characterized, its function as a fluoride transporter suggests structural similarity to other characterized CrcB proteins that contain multiple transmembrane segments arranged to form a selective channel .

What experimental approaches are most effective for assessing CrcB2 function in fluoride resistance?

Evaluating CrcB2 function requires a multifaceted experimental approach. Growth inhibition assays using varying fluoride concentrations (typically 0.5-20 mM NaF) represent the fundamental method for quantifying resistance phenotypes. Complementary techniques include:

  • Gene knockout/complementation studies to establish causality between CrcB2 expression and fluoride resistance

  • Fluoride-specific electrode measurements to directly quantify intracellular vs. extracellular fluoride concentrations

  • Protein localization studies using GFP fusions to confirm membrane integration

  • Heterologous expression systems (e.g., E. coli lacking endogenous fluoride transporters) to assess function in isolation

A comprehensive approach would include assessment of expression patterns under different fluoride stress conditions using RT-qPCR or RNA-seq to identify potential regulatory mechanisms .

How can researchers address challenges in expressing and purifying functional recombinant CrcB2?

Expression and purification of membrane proteins like CrcB2 present significant challenges. Recommended approaches include:

ChallengeMethodological Solution
Low expression yieldsUse specialized expression strains (C41/C43); optimize codon usage for E. coli; employ strong inducible promoters with fine-tuned expression conditions
Protein misfoldingExpress at lower temperatures (16-20°C); include membrane-mimetic environments during purification
Aggregation during purificationUse appropriate detergents (DDM, LMNG) for extraction; implement stepwise detergent exchange during purification
Functional assessmentDevelop reconstitution protocols in proteoliposomes for transport assays
Protein stabilityInclude stabilizing additives (glycerol 6-10%); avoid repeated freeze-thaw cycles

For optimal results with Moorella thermoacetica CrcB2, expression in E. coli with an N-terminal His tag allows for affinity purification while minimizing interference with transmembrane domain insertion .

What are the current contradictions in our understanding of CrcB2 function compared to other fluoride channels?

Several contradictions exist in our current understanding of CrcB2 function:

How should researchers design expression systems for recombinant Moorella thermoacetica CrcB2?

When designing expression systems for recombinant Moorella thermoacetica CrcB2, researchers should consider the following protocol:

  • Vector selection: Use pET-based vectors with T7 promoter systems for tight regulation and high expression potential.

  • Tag placement: Incorporate an N-terminal His tag (6-10 histidines) with a TEV protease cleavage site to facilitate purification while allowing tag removal.

  • Expression strain: E. coli BL21(DE3) or specialized membrane protein expression strains like C41(DE3) or C43(DE3) are recommended.

  • Expression conditions:

    • Culture in rich media (LB or TB) to OD600 of 0.6-0.8

    • Induce with low IPTG concentrations (0.1-0.5 mM)

    • Express at reduced temperature (18-25°C) for 16-20 hours

    • Include membrane integrity preservatives (1% glucose) in media

  • Harvest and storage: Collect cells by centrifugation and store pellets at -80°C in buffer containing 10% glycerol as a cryoprotectant .

What are the optimal conditions for assessing CrcB2-mediated fluoride transport?

To effectively assess CrcB2-mediated fluoride transport, researchers should implement these methodological approaches:

  • In vivo resistance assays:

    • Gradient plate method: Pour plates with increasing fluoride concentration gradients (0-10 mM)

    • Growth curve analysis in media containing defined fluoride concentrations

    • Determine minimum inhibitory concentration (MIC) using serial dilution assays

  • Direct transport measurements:

    • Develop fluoride-selective electrode-based assays to measure intracellular fluoride accumulation

    • Use radiolabeled fluoride (18F) for high-sensitivity detection in transport assays

    • Implement fluoride-sensitive fluorescent probes for real-time imaging

  • Reconstituted system assays:

    • Purify CrcB2 and reconstitute into proteoliposomes

    • Perform liposome swelling assays with different anions to determine selectivity

    • Use stopped-flow spectrophotometry with pH-sensitive dyes to detect counterion movements

  • Control experiments:

    • Include protein-free liposomes as negative controls

    • Use known fluoride transport inhibitors to confirm specificity

    • Compare wild-type CrcB2 with site-directed mutants to identify key functional residues

How can researchers differentiate between CrcB1 and CrcB2 functions in bacterial species that possess both proteins?

Differentiating the specific functions of CrcB1 and CrcB2 requires targeted experimental approaches:

  • Single and double gene knockouts: Generate ΔcrcB1, ΔcrcB2, and ΔcrcB1ΔcrcB2 mutants to assess individual and combined contributions to fluoride resistance.

  • Complementation analysis: Test whether expression of either gene can restore resistance in the double knockout, which would indicate functional redundancy.

  • Expression pattern analysis: Use promoter-reporter fusions (luciferase or GFP) to determine if the genes are differentially regulated under various conditions or growth phases.

  • Protein localization studies: Employ fluorescently-tagged constructs to determine if CrcB1 and CrcB2 localize to different regions within the cell membrane.

  • Electrophysiological characterization: Apply patch-clamp techniques to compare channel properties including conductance, selectivity, and gating between CrcB1 and CrcB2.

  • Protein-protein interaction studies: Investigate whether CrcB1 and CrcB2 form heteromeric complexes or interact with different cellular partners using co-immunoprecipitation or bacterial two-hybrid assays .

How can CrcB2 research contribute to understanding bacterial resistance to environmental stressors?

Research on CrcB2 provides valuable insights into bacterial adaptation mechanisms:

  • CrcB2 represents a specialized adaptation to fluoride toxicity, offering a model system for studying how bacteria evolve resistance to specific environmental toxins. Understanding this mechanism may reveal principles applicable to other stress response systems.

  • The distribution of CrcB2 across bacterial species correlates with ecological niches and exposure to fluoride-rich environments, demonstrating environment-specific selective pressures.

  • CrcB2 research illuminates the evolution of membrane transport systems, particularly how channel specificity develops for toxic ions versus essential nutrients.

  • The regulatory networks controlling CrcB2 expression likely interconnect with broader stress response pathways, potentially revealing cross-protection mechanisms against multiple environmental challenges .

What are emerging applications of recombinant CrcB proteins in synthetic biology?

Recombinant CrcB proteins present several promising applications in synthetic biology:

  • Engineered fluoride biosensors: CrcB-based sensing systems could detect environmental fluoride contamination with high specificity.

  • Biocontainment strategies: Engineered bacteria requiring specific fluoride concentrations for survival could serve as environmentally-contained synthetic organisms.

  • Membrane protein engineering platforms: CrcB's relatively simple structure provides a template for designing novel ion-selective channels with modified specificities.

  • Bioremediation applications: Bacteria with enhanced fluoride transport capacity through optimized CrcB expression could potentially remediate fluoride-contaminated environments.

  • Metabolic engineering tools: Modified CrcB proteins could control ionic balances for optimized fermentation or bioproduction processes in industrial microbiology .

What fundamental questions about CrcB2 remain unanswered?

Despite progress in understanding CrcB proteins, several fundamental questions remain:

  • Structural determinants of function: What specific amino acid residues and structural motifs confer fluoride selectivity versus other anions?

  • Evolutionary history: Did CrcB proteins evolve exclusively for fluoride detoxification, or did they adapt from transporters with other original functions?

  • Regulatory mechanisms: What transcriptional and post-translational controls modulate CrcB2 expression and activity in response to environmental conditions?

  • Species-specific adaptations: How have CrcB proteins in different bacterial species adapted to various ecological niches with different fluoride exposure levels?

  • Transport mechanism: What is the precise bioenergetic mechanism driving fluoride transport (channel vs. active transport), and what counterions may be involved?

  • Protein-protein interactions: Do CrcB proteins function independently or as part of larger multiprotein complexes within the membrane?

What are the recommended protocols for site-directed mutagenesis studies of CrcB2?

Site-directed mutagenesis represents a critical approach for investigating structure-function relationships in CrcB2. The following protocol is recommended:

  • Target selection:

    • Conserved residues identified through sequence alignment across diverse CrcB homologs

    • Charged residues within predicted transmembrane domains

    • Residues lining putative channel pores based on structural models

  • Mutagenesis protocol:

    • Use overlap extension PCR or commercial kits (QuikChange)

    • Design primers with mutations centrally located within 25-35 nucleotide sequences

    • Verify successful mutagenesis through sequencing before expression

  • Functional analysis workflow:

    • Express wild-type and mutant proteins in parallel

    • Quantify expression levels via Western blotting

    • Assess membrane localization using fractionation techniques

    • Measure fluoride resistance using standardized MIC assays

    • For functionally important residues, perform conservative and non-conservative substitutions

  • Data interpretation framework:

    • Classify mutations by phenotype (non-functional, partially functional, enhanced function)

    • Map functional residues onto predicted structural models

    • Correlate findings with evolutionary conservation patterns

How can researchers troubleshoot common challenges in CrcB2 functional studies?

ChallengePossible CausesTroubleshooting Approach
Low protein expressionToxicity of overexpressed membrane protein; inefficient codon usageUse tightly regulated expression systems; reduce induction strength; optimize codons for expression host; test multiple fusion tags
Poor membrane integrationImproper signal recognition; protein aggregationOptimize signal sequences; reduce expression temperature; include membrane-stabilizing additives (glycerol, specific lipids)
Inconclusive fluoride resistance assaysBackground fluoride transport activity; variable initial cell densityUse appropriate genetic background (knockout strains); strictly standardize inoculum OD; include positive controls (known fluoride transporters)
Inconsistent purification resultsDetergent incompatibility; protein instabilityScreen multiple detergents systematically; add stabilizers (glycerol, specific lipids); maintain cold temperatures throughout purification
Failed reconstitution in liposomesImproper protein:lipid ratio; detergent interferenceOptimize protein:lipid ratios (1:50 to 1:200); ensure complete detergent removal; test different lipid compositions

Implementation of this systematic troubleshooting approach will significantly improve success rates in CrcB2 functional studies .

How does current knowledge about CrcB2 integrate with broader understanding of bacterial ion transport mechanisms?

CrcB2 research provides important insights into bacterial membrane transport biology. These fluoride-specific channels represent specialized adaptations that have evolved to address a specific environmental challenge. The distribution of CrcB homologs across bacterial species, including thermophiles like Moorella thermoacetica, demonstrates the evolutionary importance of fluoride detoxification mechanisms.

The study of CrcB2 contributes to our understanding of ion channel selectivity, as these proteins must discriminate between fluoride and other physiologically relevant anions. Furthermore, the relationship between different fluoride resistance mechanisms (EriC and CrcB systems) illustrates how bacteria have developed multiple solutions to address the same biological problem, with different species employing distinct combinations of these systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.