Recombinant Mopeia virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Mopeia Virus Pre-glycoprotein Polyprotein GP Complex (GPC)

Recombinant Mopeia virus Pre-glycoprotein polyprotein GP complex (GPC) refers to a genetically engineered version of the Mopeia virus (MOPV) GPC, which is designed to serve as a vaccine platform against arenaviruses . The GPC is a surface glycoprotein that is crucial for the virus's ability to enter host cells and is a key target for neutralizing antibodies . By modifying the MOPV genome, scientists can introduce the GPC from other arenaviruses, such as the Lassa virus (LASV), to create targeted vaccines .

Development and Rationale

The development of recombinant Mopeia virus GPC is rooted in the need for a safe and effective vaccine against arenaviruses, particularly LASV, which causes Lassa fever . The approach involves using a modified, weakened version of MOPV, named MOPEVAC, as a backbone to express the GPC of other pathogenic arenaviruses .

Key steps in the development include:

  • Attenuation of MOPV: The MOPV is modified to reduce its ability to replicate and cause disease. This is achieved by knocking out the exonuclease (ExoN) activity, which is essential for viral replication .

  • Introduction of Heterologous GPC: The GPC gene of a target arenavirus, such as LASV, is inserted into the MOPEVAC backbone. This allows the recombinant virus to express the GPC of the pathogenic virus, stimulating an immune response .

  • Evaluation of Immunogenicity and Safety: The recombinant virus is tested in vitro and in vivo to assess its ability to induce an immune response and its safety profile .

Key Research Findings

Research on recombinant Mopeia virus GPC has yielded several significant findings:

  • Safety: Studies have shown that the modified MOPV with ExoN knockout is highly attenuated, meaning it has a reduced ability to cause disease. This makes it a safe platform for vaccine development .

  • Immunogenicity: Recombinant Mopeia virus GPC can induce strong immune responses, including the production of neutralizing antibodies and T-cell activation . For example, MOPEVAC expressing LASV GPC (MOPEVAC LAS) has been shown to generate robust humoral and T-cell responses in cynomolgus macaques .

  • Efficacy: Vaccination with recombinant Mopeia virus GPC has demonstrated protection against arenavirus challenge in animal models. In one study, all cynomolgus macaques immunized with MOPEVAC LAS survived a challenge with LASV, while all control animals succumbed to the disease .

Replication Capacity of MOPV Strains in Monocytes

Virus StrainReplication Capacity in Monocyte-Derived Macrophages
Natural MOPV WTSustained multiplication
Recombinant MOPV WTSustained multiplication
Recombinant MOPV ExoNNo detectable infectious virus

Immune Response in Monocytes Infected with MOPV Strains

Activation MarkerNatural/Recombinant MOPV WTRecombinant MOPV ExoN
CD40Increased expressionSignificant increase
CD80Increased expressionSignificant increase
CD86Increased expressionIncreased expression

Type I Interferon (IFN) Response in Infected Monocytes

InterferonNatural/Recombinant MOPV WTRecombinant MOPV ExoN
IFN-βRobust increaseRobust increase
IFN-α1Robust increaseRobust increase
IFN-α2Robust increaseRobust increase

Clinical Significance and Future Directions

The recombinant Mopeia virus GPC platform holds considerable promise for the development of vaccines against arenaviruses . The ability to induce strong and protective immune responses in animal models suggests that this approach could be effective in humans .

Future research directions include:

  • Safety and Efficacy Studies in Humans: Clinical trials are needed to evaluate the safety and efficacy of recombinant Mopeia virus GPC vaccines in humans.

  • Understanding Mechanisms of Action: Further research is needed to elucidate the molecular mechanisms by which recombinant Mopeia virus GPC induces immune responses. This includes studying how the vaccine activates T cells and B cells, as well as the role of neutralizing antibodies in protection .

  • Expanding the Platform: The Mopeia virus GPC platform can be expanded to develop vaccines against other arenaviruses and potentially other viral pathogens .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, and this can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-489
Protein Length
Full Length of Mature Protein
Species
Mopeia virus (MOPV)
Target Names
GPC
Target Protein Sequence
GQIVTFFQEVPHILEEVMNIVLMTLSILAILKGIYNVMTCGIIGLITFLFLCGRSCSSIYKDNYEFFSLDLDMSSLNATMPLSCSKNNSHHYIQVGNETGLELTLTNTSIINHKFCNLSDAHRRNLYDKALMSILTTFHLSIPDFNQYEAMSCDFNGGKISVQYNLSHSNYVDAGNHCGTIANGIMDVFRRMYWSTSLSVASDISGTQCIQTDYKYLIIQNTSWEDHCMFSRPSPMGFLSLLSQRTRNFYISRRLLGLFTWTLSDSEGNDMPGGYCLTRSMLIGLDLKCFGNTAIAKCNQAHDEEFCDMLRLFDFNKQAISKLRSEVQQSINLINKAVNALINDQLVMRNHLRDLMGIPYCNYSKFWYLNDTRTGRTSLPKCWLVTNGSYLNETQFSTEIEQEANNMFTDMLRKEYEKRQSTTPLGLVDLFVFSTSFYLISVFLHLIKIPTHRHIKGKPCPKPHRLNHMAICSCGFYKQPGLPTQWKR
Uniprot No.

Target Background

Function
This class I viral fusion protein mediates fusion between viral and host endosomal membranes, delivering the nucleocapsid into the cytoplasm. Membrane fusion is triggered by irreversible conformational changes induced by endosomal acidification. The stable signal peptide (SSP) is cleaved and functions as a signal peptide, but is also retained as part of the GP complex. The SSP is essential for efficient glycoprotein expression, post-translational maturation (GP1 and GP2 cleavage), glycoprotein transport to the cell membrane, virion formation, and acid pH-dependent cell fusion mediated by the glycoprotein. This protein also interacts with the host receptor.
Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Mopeia virus pre-glycoprotein polyprotein GP complex?

Mopeia virus GPC is an envelope glycoprotein that undergoes post-translational processing to yield mature glycoproteins GP1 and GP2. The full-length polyprotein contains approximately 489 amino acids, with GP1 mediating receptor binding and GP2 facilitating membrane fusion. Based on recombinant protein studies, the mature GP complex retains structural similarities to other arenavirus glycoproteins, particularly Lassa virus GPC, reflecting their close phylogenetic relationship . Processing of recombinant GPC expressed in producer cell lines closely resembles that observed during natural virus infection, showing the characteristic pattern of higher-molecular-weight GPC and processed GP1/GP2 subunits on immunoblot analysis .

How does Mopeia virus GPC compare functionally to Lassa virus GPC?

Mopeia virus GPC shares significant structural homology with Lassa virus GPC, though with important functional differences that may contribute to the reduced pathogenicity of Mopeia virus. Both proteins undergo similar proteolytic processing to generate GP1 and GP2 subunits necessary for receptor binding and membrane fusion. In experimental systems, Mopeia virus GPC can be incorporated into virus-like particles (VLPs) in a manner similar to Lassa virus GPC . Expression studies demonstrate that GPC processing in producer cell lines infected with Mopeia virus-based recombinant particles closely resembles the pattern observed during natural virus infection, as confirmed by immunoblot analysis showing characteristic GP1 and GP2 bands .

What expression systems are effective for producing recombinant Mopeia virus GPC?

Several expression systems have proven effective for recombinant Mopeia virus GPC production:

Expression SystemAdvantagesLimitationsKey Applications
E. coliHigh yield, cost-effective, suitable for structural studies of specific domainsLimited post-translational modifications, potential misfoldingProtein-protein interaction studies, antibody production
Mammalian cells (e.g., Vero, BHK-21)Authentic post-translational modifications, proper foldingLower yield, higher costFunctional studies, vaccine development, virus-like particle production
Stable cell lines (e.g., Vero-LASV-GPCco)Consistent expression, authentic processingTime-consuming to generateVRP production, high-throughput screening

For functional studies requiring properly processed glycoproteins, mammalian expression systems are preferred as they enable accurate post-translational modifications similar to those observed during natural infection .

What methods are recommended for detecting recombinant Mopeia virus GPC expression?

The most effective methods for detecting recombinant Mopeia virus GPC expression include:

  • Western blotting: Using antibodies specific to GPC, GP1, or GP2, or to epitope tags (e.g., His-tag) if present in the recombinant construct. This allows visualization of both the precursor GPC and its processed forms (GP1/GP2) .

  • Immunofluorescence assays: For cellular localization studies, immunofluorescence using specific antibodies can determine the distribution of GPC in transfected or infected cells, particularly its presence at the cell surface .

  • Flow cytometry: Useful for quantifying cell surface expression when using live, non-permeabilized cells labeled with anti-GPC antibodies.

  • ELISA: Effective for quantitative assessment of soluble GPC or its subunits in purified preparations.

When analyzing processing efficiency, it is particularly informative to compare the ratio of precursor GPC to mature GP1/GP2 using quantitative immunoblotting techniques .

How can one optimize the incorporation of Mopeia virus GPC into virus-like particles (VLPs)?

Optimizing Mopeia virus GPC incorporation into VLPs requires careful consideration of several factors:

  • Co-expression strategy: The most efficient incorporation occurs when GPC is co-expressed with the viral matrix Z protein. Experimental data demonstrates that Z protein promotes the association of viral proteins with cellular membranes, facilitating their incorporation into budding VLPs .

  • Protein ratio optimization: The ratio of GPC to Z protein expression should be carefully titrated, as overexpression of either component may reduce incorporation efficiency. Typically, a 1:1 to 1:2 ratio of GPC to Z expression plasmids yields optimal results in transfection-based systems .

  • Membrane targeting signals: Preserving the authentic membrane-targeting signals within GPC is crucial. Modifications to the transmembrane domain or cytoplasmic tail can significantly impact GPC incorporation efficiency. Comparative studies with other arenavirus GPCs suggest that species-specific differences in these regions may affect VLP incorporation .

  • Producer cell selection: Different cell lines vary in their ability to support efficient VLP production. Human embryonic kidney 293T cells and African green monkey kidney Vero cells have shown good efficiency for arenavirus VLP production .

  • Purification approach: For optimal recovery of GPC-containing VLPs, ultracentrifugation through a 20% sucrose cushion followed by protease protection assays can confirm the incorporation of GPC into lipid-enveloped particles .

What are the molecular interactions between Mopeia virus GPC and the viral matrix Z protein during virion assembly?

The molecular interaction between Mopeia virus GPC and Z protein during virion assembly involves complex mechanisms:

  • Direct vs. indirect interactions: Unlike the nucleoprotein (NP), which shows selective incorporation into Z-induced VLPs, direct binding between GPC and Z protein has been difficult to demonstrate through conventional co-immunoprecipitation assays . This suggests that their interaction may be transient or mediated by additional cellular factors.

  • Membrane microdomains: Both Z protein and GPC localize to specific membrane microdomains during viral assembly. Immunofluorescence studies reveal that Z protein promotes the relocalization of viral proteins to these assembly sites, appearing as distinct punctate structures in the cytoplasm .

  • Cytoplasmic tail recognition: The cytoplasmic tail of GPC likely contains specific recognition motifs for Z protein. Research with chimeric glycoproteins, such as those combining Lassa virus GPC with LCMV cytoplasmic tails, demonstrates that these domains are critical for efficient virion incorporation .

  • Assembly kinetics: The temporal aspects of GPC-Z interaction appear important. Z protein first associates with membranes, likely creating a scaffold that subsequently recruits GPC and the ribonucleoprotein complex to assembly sites .

  • Host factors: Cellular proteins may facilitate GPC-Z interactions, potentially including components of the ESCRT (Endosomal Sorting Complexes Required for Transport) machinery that have been implicated in arenavirus budding.

How do mutations in the Mopeia virus GPC affect immune activation compared to Lassa virus GPC?

The impact of mutations in Mopeia virus GPC on immune activation reveals important differences from Lassa virus:

What methodological approaches are most effective for studying GPC processing and maturation?

The most effective methodological approaches for studying Mopeia virus GPC processing and maturation include:

  • Pulse-chase analysis: This technique allows tracking of GPC processing kinetics from synthesis to maturation by labeling newly synthesized proteins with radioactive amino acids and following their fate over time. Key time points for arenavirus GPC typically include 15, 30, 60, and 120 minutes post-labeling.

  • Site-directed mutagenesis: Systematic modification of potential cleavage sites, glycosylation motifs, or trafficking signals can identify critical regions for GPC processing. The high-fidelity Phusion site-directed mutagenesis approach has been successfully used for creating GPC variants .

  • Glycosidase treatment: Treatment of GPC-containing samples with enzymes like PNGase F or Endo H can reveal the glycosylation state and trafficking progress through the secretory pathway.

  • Subcellular fractionation: This approach separates cellular compartments to track GPC localization during processing. Density gradient centrifugation can effectively separate ER, Golgi, and plasma membrane fractions.

  • Protease inhibitor studies: Using specific inhibitors of subtilisin kexin isozyme-1/site-1 protease (SKI-1/S1P) helps determine the dependence of GPC processing on this cellular enzyme.

  • Confocal microscopy with compartment markers: Co-localization studies using markers for the ER (e.g., calnexin), Golgi (e.g., GM130), and plasma membrane enable visualization of GPC trafficking during maturation.

  • Mass spectrometry: This technique provides precise identification of cleavage sites and post-translational modifications. For comprehensive analysis, a combination of tryptic and non-tryptic digestion followed by LC-MS/MS is recommended.

What are the critical considerations when designing recombinant vaccine vectors based on Mopeia virus GPC?

When designing recombinant vaccine vectors based on Mopeia virus GPC, researchers should consider:

  • Immunogenicity balance: Mopeia virus GPC offers a natural balance between safety and immunological cross-reactivity with Lassa virus. Research indicates that Mopeia virus-based constructs can elicit protective immune responses against Lassa virus challenge while maintaining an attenuated phenotype .

  • Innate immune activation: To enhance vaccine efficacy, consider combining Mopeia virus GPC with modifications that prevent viral evasion of innate immunity. Experimental data shows that disrupting the NP exonuclease activity through D389A/G392A mutations significantly enhances innate immune activation, potentially improving vaccine immunogenicity .

  • Single-cycle replication systems: Virus replicon particles (VRPs) that undergo only a single round of replication offer improved safety while maintaining immunogenicity. This can be achieved by replacing the gene for GPC with a fluorescent reporter (e.g., ZsG) in the S segment while providing GPC in trans from stable producer cell lines .

  • Cross-protection assessment: When designing Mopeia virus GPC-based vaccines against Lassa fever, rigorous evaluation of cross-protection is essential. Guinea pig models have demonstrated that NP appears to be the preferred protective antigen in some systems, suggesting that combining GPC and NP might provide superior protection .

  • Vector selection: The choice between DNA vaccines, viral vectors, or VRPs significantly impacts immunogenicity. Data from guinea pig studies suggests that replication-competent systems elicit stronger immune responses than non-replicating platforms .

  • Glycosylation considerations: Ensure that expression systems maintain authentic glycosylation patterns of GPC, as these post-translational modifications influence both antigenicity and immunogenicity.

Why might recombinant Mopeia virus GPC show limited incorporation into virus-like particles despite robust expression?

Limited incorporation of recombinant Mopeia virus GPC into VLPs despite strong expression can result from several factors:

  • Improper protein folding: Even with high expression levels, improperly folded GPC may fail to reach the plasma membrane or interact correctly with Z protein. Verify proper folding through conformation-specific antibodies or functional assays.

  • Suboptimal Z protein colocalization: Research demonstrates that efficient incorporation requires colocalization of GPC with Z protein at membrane assembly sites. Immunofluorescence studies show that when expressed alone, Mopeia virus NP distributes throughout the cytoplasm in variable-sized aggregates, but coexpression with Z changes this localization pattern, with 67.4% of NP colocalizing with Z . Similar principles likely apply to GPC incorporation.

  • Competing cellular proteins: Overexpression of GPC may lead to interactions with cellular factors that sequester it away from VLP assembly sites. Titration experiments with varying ratios of GPC and Z expression vectors can help determine optimal conditions.

  • Defective membrane targeting: Mutations or modifications to the transmembrane domain or cytoplasmic tail may disrupt proper membrane insertion or lateral organization. Studies with Lassa/LCMV chimeric glycoproteins demonstrate that these regions are critical for virion incorporation .

  • Lack of additional viral components: Some arenaviruses may require other viral proteins besides Z for efficient GPC incorporation. Consideration of NP co-expression may improve results, as studies show that Z protein promotes the association of NP with cellular membranes .

  • Cell type-specific factors: Different cell lines provide varying environments for VLP assembly. While 293T cells are commonly used, other cell types may offer improved efficiency for Mopeia virus VLP production.

What analytical approaches can resolve contradictory results when comparing Mopeia virus GPC with Lassa virus GPC?

When facing contradictory results in comparative studies of Mopeia and Lassa virus GPCs, consider these analytical approaches:

  • Sequence-based analysis: Begin with comprehensive sequence alignment of the GPCs from both viruses, focusing on known functional domains. Pay particular attention to the signal peptide, GP1-GP2 cleavage site, transmembrane domain, and cytoplasmic tail, as these regions often dictate functional differences.

  • Domain-swapping experiments: Create chimeric constructs exchanging discrete domains between Mopeia and Lassa virus GPCs to identify which regions are responsible for phenotypic differences. This approach has successfully identified functional domains in related arenaviruses .

  • Controlled expression systems: Ensure comparable expression levels by using identical promoters and expression systems for both GPCs. Consider using inducible systems with titrated induction to achieve matched expression levels.

  • Quantitative biochemical analysis: Apply rigorous quantification to western blots and other assays using appropriate loading controls and standard curves. For processing efficiency, calculate the ratio of precursor GPC to mature GP1/GP2 subunits.

  • Multi-cell line validation: Test both GPCs in multiple relevant cell lines to identify potential cell-type specific effects. Primary cells from natural host species may reveal differences not apparent in common laboratory cell lines.

  • Functional readouts: Supplement biochemical assays with functional readouts such as:

    • Pseudotyped virus entry assays

    • Cell-cell fusion assays

    • Receptor binding studies

    • Antibody neutralization profiles

  • Controlled immunological assessment: When comparing immune responses, use matched antigen doses and standardized immune readouts in the same experimental system, ideally including positive and negative controls.

How can researchers address difficulties in producing stable recombinant Mopeia virus GPC constructs?

Researchers encountering difficulties with stable recombinant Mopeia virus GPC constructs can implement these strategies:

  • Codon optimization: Native arenavirus sequences often contain suboptimal codon usage for expression in mammalian cells. Research shows that GPC expressed by a stable cell line with codon-optimized sequences can be processed similarly to virus-infected cells .

  • Inducible expression systems: For potentially toxic proteins, inducible systems like Tet-On or Tet-Off allow controlled expression only when needed. This approach can prevent selection against high-expressing clones during stable cell line generation.

  • Strategic truncations: Consider creating constructs lacking known toxic domains while retaining essential regions for the research question. For example, studies with Mopeia virus NP showed that the C-terminal half plays a crucial role in VLP incorporation .

  • Fusion partners: Addition of stabilizing fusion partners like thioredoxin, SUMO, or MBP can improve protein folding and stability. The recombinant Mopeia virus GPC has been successfully produced with an N-terminal His-tag in E. coli systems .

  • IRES-based bicistronic systems: For selection marker co-expression, IRES elements can ensure that both the selection marker and GPC are transcribed as a single mRNA, preventing loss of GPC expression while maintaining selection.

  • Alternative promoters: If conventional CMV or EF1α promoters yield unstable expression, test alternative promoters like CAG, which has been successfully used for expressing arenavirus proteins .

  • Growth condition optimization: For stable cell lines, optimizing growth conditions (temperature, serum concentration, cell density) can significantly impact GPC expression and stability. Reduced temperature (30-34°C) often improves expression of difficult-to-express membrane proteins.

What are the most reliable positive and negative controls for functional studies of Mopeia virus GPC?

For functional studies of Mopeia virus GPC, the following controls are recommended:

Positive Controls:

  • Authentic Mopeia virus infection: When biosafety facilities permit, authentic virus provides the gold standard positive control, demonstrating natural GPC processing and function.

  • Lassa virus GPC: As a close relative sharing approximately 75-80% amino acid identity, Lassa virus GPC serves as an excellent positive control, particularly for cross-reactive antibodies and functional assays .

  • LCMV GPC: For biosafety level 2 facilities, lymphocytic choriomeningitis virus (LCMV) GPC offers a safer alternative that maintains core arenavirus GPC functions .

  • Validated GPC mutants: Well-characterized mutants with known phenotypes provide reliable reference points. For example, constructs with mutations at the GP1-GP2 cleavage site can serve as processing controls.

Negative Controls:

  • Empty vector transfection: Essential for distinguishing specific GPC-mediated effects from background or transfection-related phenomena.

  • Unrelated viral glycoproteins: Glycoproteins from unrelated viruses (e.g., influenza hemagglutinin, VSV-G) help confirm the specificity of arenavirus GPC effects. Studies have shown that Ebola virus NP and influenza virus NP are not incorporated into Mopeia virus Z-induced VLPs, confirming the selectivity of arenavirus protein interactions .

  • Misfolded GPC variants: GPC constructs with mutations disrupting critical disulfide bonds or glycosylation sites serve as folding/processing controls.

  • UV-inactivated preparations: For studies examining GPC-mediated signaling or immune responses, UV-inactivated preparations can differentiate between effects requiring replication and those mediated simply by GPC binding .

What novel approaches might enhance the utility of Mopeia virus GPC in next-generation vaccine platforms?

Emerging approaches to enhance Mopeia virus GPC utility in vaccines include:

  • Nanoparticle display technology: Multimerization of GPC on self-assembling nanoparticles may enhance immunogenicity by mimicking the dense arrangement on virions while enabling precise control of antigen presentation.

  • mRNA vaccine platforms: Encapsulated mRNA encoding Mopeia virus GPC in lipid nanoparticles could provide efficient in vivo expression with correct post-translational modifications, potentially eliciting stronger immune responses than protein subunit approaches.

  • Computationally optimized epitope presentation: Structure-guided modifications of GPC to better expose conserved neutralizing epitopes shared with Lassa virus could enhance cross-protection while maintaining the safety profile of Mopeia virus.

  • VRP platform refinement: Building upon existing virus replicon particle technology, incorporation of molecular adjuvants such as innate immune stimulators could enhance vaccine immunogenicity. Research shows that NP exonuclease mutations (D389A/G392A) significantly enhance innate immune activation, which could be combined with GPC expression .

  • Prime-boost heterologous strategies: Sequential immunization with different GPC-expressing platforms (e.g., DNA prime followed by VRP boost) might enhance both the magnitude and breadth of immune responses.

  • T cell epitope enhancement: Modification of GPC to incorporate additional conserved T cell epitopes could improve the cellular immune response, which appears particularly important for arenavirus protection. Guinea pig studies suggest that NP may be the preferred protective antigen in some models, indicating potential benefit from combined GPC-NP approaches .

How might structural biology approaches advance our understanding of Mopeia virus GPC functions?

Structural biology approaches offer significant potential for advancing Mopeia virus GPC research:

  • Cryo-electron microscopy (Cryo-EM): High-resolution structures of full-length Mopeia virus GPC in different conformational states (pre-fusion, post-fusion) would provide unprecedented insights into fusion mechanisms and receptor interactions. Comparative analysis with Lassa virus GPC structures could identify structural determinants of pathogenicity differences.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can map dynamic regions of GPC involved in conformational changes during the fusion process, providing insights into the molecular trigger mechanisms without requiring crystallization.

  • Single-molecule Förster resonance energy transfer (smFRET): By strategically placing fluorophores on recombinant GPC, researchers could monitor real-time conformational changes during receptor binding and fusion activation, revealing the kinetics of these critical events.

  • Cross-linking mass spectrometry (XL-MS): This approach can identify interaction interfaces between GPC and viral or cellular partners, including the elusive interactions with the Z protein that have been difficult to detect by conventional co-immunoprecipitation methods .

  • Molecular dynamics simulations: Computational methods can model GPC behavior in membrane environments and predict the effects of mutations or small-molecule binders, guiding rational drug design efforts.

  • In situ structural analysis: Correlative light and electron microscopy (CLEM) combined with cryo-electron tomography could visualize GPC organization within virions and at budding sites, providing context for how GPC interacts with other viral components in the native assembly environment.

What are the most significant recent advances in Mopeia virus GPC research?

The most significant recent advances in Mopeia virus GPC research include:

  • Development of reverse genetics systems allowing the creation of recombinant viruses and virus-like particles containing Mopeia virus proteins, enabling detailed functional studies of GPC in controlled laboratory settings .

  • Characterization of the selective incorporation mechanisms of viral proteins into Z-induced virus-like particles, demonstrating that this process is highly specific and likely mediated through protein-protein interactions at cellular membranes .

  • Creation of virus replicon particles (VRPs) with single-cycle infectivity, providing safer platforms for studying Mopeia virus GPC functions and for potential vaccine development .

  • Improved understanding of the comparative immunology between Mopeia virus and Lassa virus, showing differential activation of innate immune responses that may explain their pathogenicity differences .

  • Establishment of stable cell lines expressing Mopeia and Lassa virus glycoproteins with authentic processing, facilitating the production of research reagents and potential vaccine candidates .

  • Development of chimeric viruses combining elements from Mopeia virus, Lassa virus, and LCMV, providing important tools for identifying functional domains and for studying viral evolution and host adaptation .

  • Advances in recombinant protein production systems, enabling the expression and purification of defined regions of Mopeia virus GPC for structural and immunological studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.